Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LGZ7

Protein Details
Accession E2LGZ7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-55APSQRSQPSRKGKRTWRKNVDLDDHydrophilic
NLS Segment(s)
PositionSequence
39-45PSRKGKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
KEGG mpr:MPER_05742  -  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MAKEKPNADSHRVGNTSIAKSKQKVTKSAIGAPSQRSQPSRKGKRTWRKNVDLDDVEEGLEEIRTQERVLGRDVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.38
4 0.37
5 0.39
6 0.36
7 0.37
8 0.43
9 0.45
10 0.43
11 0.45
12 0.46
13 0.48
14 0.47
15 0.51
16 0.47
17 0.44
18 0.43
19 0.4
20 0.37
21 0.32
22 0.31
23 0.28
24 0.27
25 0.33
26 0.41
27 0.48
28 0.53
29 0.59
30 0.67
31 0.76
32 0.84
33 0.86
34 0.84
35 0.83
36 0.82
37 0.79
38 0.76
39 0.67
40 0.58
41 0.5
42 0.4
43 0.31
44 0.25
45 0.19
46 0.12
47 0.1
48 0.07
49 0.06
50 0.07
51 0.08
52 0.08
53 0.12
54 0.16
55 0.18