Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y3G7

Protein Details
Accession A0A4P9Y3G7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-110VEKLDRARRRGKGTPKKGQGKRATIKKKKBasic
NLS Segment(s)
PositionSequence
86-110DRARRRGKGTPKKGQGKRATIKKKK
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences VMSASRRMQAAELSARIFSQVWNPTGVRTGNKVLRQRPRAEHVLSYYPKPAVNFKEFREFLNADVCAWSGSPIVDVDEAERVEKLDRARRRGKGTPKKGQGKRATIKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.15
6 0.17
7 0.2
8 0.2
9 0.23
10 0.23
11 0.22
12 0.26
13 0.27
14 0.22
15 0.21
16 0.27
17 0.29
18 0.36
19 0.42
20 0.46
21 0.54
22 0.58
23 0.6
24 0.59
25 0.59
26 0.58
27 0.53
28 0.48
29 0.42
30 0.43
31 0.39
32 0.35
33 0.31
34 0.26
35 0.25
36 0.23
37 0.24
38 0.21
39 0.25
40 0.27
41 0.27
42 0.35
43 0.35
44 0.34
45 0.36
46 0.31
47 0.26
48 0.27
49 0.25
50 0.17
51 0.16
52 0.16
53 0.1
54 0.1
55 0.1
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.13
71 0.17
72 0.24
73 0.3
74 0.38
75 0.47
76 0.53
77 0.6
78 0.66
79 0.73
80 0.75
81 0.78
82 0.81
83 0.83
84 0.87
85 0.86
86 0.87
87 0.85
88 0.85
89 0.84
90 0.85