Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y0P4

Protein Details
Accession A0A4P9Y0P4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
62-84RQVQRRTRDRHAQHHQRCQARRKBasic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014848  Rgp1  
Pfam View protein in Pfam  
PF08737  Rgp1  
Amino Acid Sequences YTLAYGDKKVGRVRLPRSNHRLGEPVSGVLDLTDAEFACYHVTITLESLERVEPSYSRISPRQVQRRTRDRHAQHHQRCQARRKIGFSLHAPNWASADFETTIGSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.68
4 0.71
5 0.74
6 0.69
7 0.63
8 0.61
9 0.53
10 0.51
11 0.41
12 0.34
13 0.26
14 0.23
15 0.2
16 0.14
17 0.12
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.06
41 0.09
42 0.13
43 0.13
44 0.16
45 0.18
46 0.22
47 0.27
48 0.36
49 0.44
50 0.49
51 0.56
52 0.62
53 0.7
54 0.73
55 0.75
56 0.76
57 0.73
58 0.75
59 0.77
60 0.79
61 0.78
62 0.82
63 0.81
64 0.8
65 0.81
66 0.8
67 0.78
68 0.77
69 0.73
70 0.68
71 0.67
72 0.63
73 0.62
74 0.57
75 0.57
76 0.49
77 0.5
78 0.46
79 0.4
80 0.36
81 0.3
82 0.27
83 0.18
84 0.2
85 0.14
86 0.14