Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y4J7

Protein Details
Accession A0A4P9Y4J7   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-82EERHREFAKCRRCRKAKYCSKECQSRAHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 13, nucl 7, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS50865  ZF_MYND_2  
Amino Acid Sequences PDMEINAFSVAERFCARWHSEEMQRWAGIVMRNGCRKDDSRGGLRQCASVSCGRWEERHREFAKCRRCRKAKYCSKECQSRAWADGHRYWCVERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.21
4 0.22
5 0.27
6 0.3
7 0.37
8 0.43
9 0.48
10 0.46
11 0.43
12 0.4
13 0.35
14 0.32
15 0.26
16 0.23
17 0.23
18 0.25
19 0.3
20 0.31
21 0.31
22 0.32
23 0.31
24 0.33
25 0.35
26 0.33
27 0.33
28 0.39
29 0.4
30 0.41
31 0.39
32 0.35
33 0.28
34 0.24
35 0.21
36 0.17
37 0.16
38 0.15
39 0.17
40 0.17
41 0.2
42 0.24
43 0.29
44 0.31
45 0.39
46 0.39
47 0.42
48 0.48
49 0.53
50 0.6
51 0.62
52 0.67
53 0.68
54 0.75
55 0.79
56 0.81
57 0.84
58 0.84
59 0.85
60 0.86
61 0.85
62 0.85
63 0.85
64 0.78
65 0.76
66 0.71
67 0.65
68 0.58
69 0.54
70 0.5
71 0.46
72 0.5
73 0.46
74 0.43
75 0.41