Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y0K5

Protein Details
Accession A0A4P9Y0K5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
195-216REEFFRLKKVQNKKKEEKAAAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002699  V_ATPase_D  
Gene Ontology GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF01813  ATP-synt_D  
Amino Acid Sequences MSGARLNIFPTRMALTTVKLKLKGAQTGHSLLKRKSEALTKRFRDVTRKIADAKMKMGRVMQTASFSLAEVAYLAGDIAYQVREGAKTAQLRVRSRMDNVSGVMLPSFEHYVEGNDVFELTGLGRGGQQVQKCKETYVDAVQTLVELASLQTAFVILDEVIKATNRRVNAIEHVIIPKLENTVSYILSELDEADREEFFRLKKVQNKKKEEKAAAEGTNVEIELPTIGDDGTVNNLLAADADDDVIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.29
4 0.35
5 0.37
6 0.36
7 0.36
8 0.38
9 0.42
10 0.45
11 0.4
12 0.38
13 0.38
14 0.41
15 0.46
16 0.46
17 0.47
18 0.42
19 0.47
20 0.44
21 0.42
22 0.41
23 0.45
24 0.48
25 0.51
26 0.6
27 0.56
28 0.6
29 0.64
30 0.63
31 0.63
32 0.59
33 0.6
34 0.55
35 0.55
36 0.52
37 0.52
38 0.55
39 0.48
40 0.49
41 0.45
42 0.4
43 0.38
44 0.37
45 0.33
46 0.29
47 0.29
48 0.24
49 0.2
50 0.19
51 0.2
52 0.17
53 0.15
54 0.13
55 0.1
56 0.09
57 0.07
58 0.06
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.08
73 0.13
74 0.14
75 0.17
76 0.21
77 0.27
78 0.29
79 0.33
80 0.36
81 0.33
82 0.33
83 0.34
84 0.33
85 0.27
86 0.26
87 0.22
88 0.18
89 0.16
90 0.13
91 0.09
92 0.07
93 0.07
94 0.07
95 0.05
96 0.06
97 0.06
98 0.07
99 0.08
100 0.08
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.04
107 0.03
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.07
114 0.09
115 0.11
116 0.17
117 0.2
118 0.23
119 0.23
120 0.23
121 0.23
122 0.22
123 0.23
124 0.21
125 0.2
126 0.17
127 0.17
128 0.16
129 0.15
130 0.12
131 0.09
132 0.05
133 0.03
134 0.03
135 0.04
136 0.04
137 0.03
138 0.03
139 0.04
140 0.03
141 0.03
142 0.04
143 0.03
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.07
150 0.09
151 0.12
152 0.12
153 0.14
154 0.16
155 0.18
156 0.21
157 0.25
158 0.23
159 0.22
160 0.23
161 0.21
162 0.2
163 0.18
164 0.14
165 0.11
166 0.1
167 0.09
168 0.1
169 0.11
170 0.12
171 0.11
172 0.11
173 0.1
174 0.1
175 0.1
176 0.08
177 0.07
178 0.07
179 0.08
180 0.09
181 0.08
182 0.09
183 0.11
184 0.13
185 0.13
186 0.18
187 0.22
188 0.28
189 0.37
190 0.47
191 0.56
192 0.64
193 0.74
194 0.77
195 0.83
196 0.86
197 0.84
198 0.79
199 0.76
200 0.73
201 0.64
202 0.56
203 0.46
204 0.37
205 0.32
206 0.25
207 0.17
208 0.1
209 0.09
210 0.07
211 0.07
212 0.06
213 0.05
214 0.05
215 0.06
216 0.06
217 0.06
218 0.1
219 0.11
220 0.1
221 0.1
222 0.1
223 0.1
224 0.1
225 0.1
226 0.07
227 0.06