Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V1IYQ1

Protein Details
Accession A0A4V1IYQ1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-84AEMERMKRERLERRRERMEKETLBasic
NLS Segment(s)
PositionSequence
74-75RR
Subcellular Location(s) cysk 22, cyto 2, nucl 1, mito 1, pero 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MAGTRLEIFRFGMYVLFPIGYMAWIGDHHWYERYVSDARRTFYGPKAEESQILPHSTEGIQAEMERMKRERLERRRERMEKETL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.06
13 0.08
14 0.09
15 0.1
16 0.11
17 0.12
18 0.12
19 0.12
20 0.15
21 0.15
22 0.16
23 0.23
24 0.25
25 0.25
26 0.26
27 0.28
28 0.26
29 0.28
30 0.33
31 0.26
32 0.26
33 0.29
34 0.29
35 0.28
36 0.27
37 0.26
38 0.22
39 0.22
40 0.19
41 0.15
42 0.16
43 0.14
44 0.15
45 0.12
46 0.1
47 0.1
48 0.09
49 0.11
50 0.13
51 0.14
52 0.16
53 0.17
54 0.2
55 0.24
56 0.33
57 0.42
58 0.49
59 0.59
60 0.66
61 0.74
62 0.82
63 0.85
64 0.84