Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Y687

Protein Details
Accession A0A4P9Y687   
Localization Confidence High
Confidence Score 20.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-50HRKALEKRRRETKMKQLKRKLSVLSBasic
134-159LSPTSAQERKRSTKRAKTQAQRIGLDHydrophilic
NLS Segment(s)
PositionSequence
27-45RKALEKRRRETKMKQLKRK
109-120GKVLKAKEKGAI
124-150EPSKSKVGRPLSPTSAQERKRSTKRAK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MVNGPSNEVGASSAMVRDLDADIAVHRKALEKRRRETKMKQLKRKLSVLSEIKDEDPCMRVESDMDVSMSEEETSDEETNDMDEVNDKIDPLERKSPIKVPVKTMNRIGKVLKAKEKGAITSSEPSKSKVGRPLSPTSAQERKRSTKRAKTQAQRIGLDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.11
11 0.11
12 0.1
13 0.1
14 0.16
15 0.23
16 0.33
17 0.41
18 0.47
19 0.56
20 0.65
21 0.73
22 0.75
23 0.77
24 0.78
25 0.8
26 0.82
27 0.84
28 0.84
29 0.85
30 0.83
31 0.8
32 0.73
33 0.66
34 0.64
35 0.59
36 0.51
37 0.44
38 0.39
39 0.35
40 0.31
41 0.28
42 0.2
43 0.16
44 0.15
45 0.13
46 0.12
47 0.11
48 0.11
49 0.12
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.09
57 0.06
58 0.05
59 0.05
60 0.05
61 0.08
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.06
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.09
77 0.11
78 0.14
79 0.2
80 0.22
81 0.24
82 0.26
83 0.31
84 0.35
85 0.43
86 0.41
87 0.41
88 0.48
89 0.52
90 0.53
91 0.56
92 0.55
93 0.49
94 0.49
95 0.44
96 0.41
97 0.43
98 0.46
99 0.46
100 0.42
101 0.41
102 0.44
103 0.44
104 0.39
105 0.33
106 0.3
107 0.25
108 0.29
109 0.3
110 0.3
111 0.3
112 0.31
113 0.34
114 0.34
115 0.36
116 0.38
117 0.42
118 0.43
119 0.48
120 0.52
121 0.52
122 0.55
123 0.53
124 0.52
125 0.55
126 0.54
127 0.56
128 0.57
129 0.61
130 0.66
131 0.73
132 0.76
133 0.78
134 0.83
135 0.86
136 0.88
137 0.89
138 0.9
139 0.89
140 0.86