Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Y7Z6

Protein Details
Accession A0A4P9Y7Z6    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-70RCRECGHRIMYKKRTKRSRSCWEEGAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, mito 8, cyto_nucl 7.833, cyto_pero 7.666, pero 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MNTDAMGMQGSQDPNGALKANAPPMIYSCADCGADNEIKPREPIRCRECGHRIMYKKRTKRSRSCWEEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.09
5 0.1
6 0.13
7 0.16
8 0.17
9 0.17
10 0.15
11 0.16
12 0.2
13 0.18
14 0.16
15 0.13
16 0.13
17 0.13
18 0.13
19 0.12
20 0.12
21 0.13
22 0.13
23 0.15
24 0.15
25 0.15
26 0.16
27 0.18
28 0.21
29 0.24
30 0.33
31 0.35
32 0.42
33 0.44
34 0.51
35 0.55
36 0.54
37 0.55
38 0.55
39 0.58
40 0.6
41 0.68
42 0.7
43 0.73
44 0.77
45 0.82
46 0.84
47 0.87
48 0.87
49 0.88
50 0.88