Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WVW7

Protein Details
Accession K1WVW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-103GANNKNRFKKTKNRRPRTSTNTPQPTLHydrophilic
NLS Segment(s)
PositionSequence
74-93LKAGANNKNRFKKTKNRRPR
Subcellular Location(s) extr 14, mito 5, plas 4, mito_nucl 4
Family & Domain DBs
KEGG mbe:MBM_09067  -  
Amino Acid Sequences MQFSLSTVLVFAAAMLAVNTTPLAEMSELQMSELQMSELQERADVLQTRSTEALAPRRIPVAAIVANGRGFNRLKAGANNKNRFKKTKNRRPRTSTNTPQPTLAPQVPQKSGGLCGFLGLSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.06
12 0.06
13 0.08
14 0.1
15 0.1
16 0.11
17 0.12
18 0.11
19 0.11
20 0.1
21 0.09
22 0.08
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.12
31 0.13
32 0.13
33 0.16
34 0.16
35 0.18
36 0.18
37 0.17
38 0.15
39 0.16
40 0.21
41 0.2
42 0.21
43 0.2
44 0.2
45 0.2
46 0.18
47 0.16
48 0.12
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.12
60 0.13
61 0.14
62 0.19
63 0.28
64 0.34
65 0.44
66 0.52
67 0.58
68 0.65
69 0.68
70 0.68
71 0.67
72 0.68
73 0.7
74 0.73
75 0.76
76 0.78
77 0.84
78 0.87
79 0.9
80 0.89
81 0.88
82 0.87
83 0.87
84 0.85
85 0.76
86 0.69
87 0.59
88 0.54
89 0.5
90 0.42
91 0.37
92 0.34
93 0.39
94 0.39
95 0.39
96 0.37
97 0.31
98 0.33
99 0.29
100 0.25
101 0.19
102 0.18