Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WPK9

Protein Details
Accession K1WPK9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-44SGNHRAPLKTYSRRKPHNTSEQTPAKRKRAHydrophilic
105-139PSSPSPKTAKPPRQLLRRRKRPKRRLTTKLDLSPIHydrophilic
NLS Segment(s)
PositionSequence
111-129KTAKPPRQLLRRRKRPKRR
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
IPR028009  ESCO_Acetyltransf_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0016746  F:acyltransferase activity  
GO:0046872  F:metal ion binding  
GO:0007049  P:cell cycle  
KEGG mbe:MBM_07122  -  
Pfam View protein in Pfam  
PF13880  Acetyltransf_13  
PF13878  zf-C2H2_3  
Amino Acid Sequences METGKAALGKMGGTSGNHRAPLKTYSRRKPHNTSEQTPAKRKRAEEPQSPEELPPAKKFAPSSIKNYFQPLSSSSSPAQTRAAHQPSDDLASRSTPPSSPPTFTPSSPSPKTAKPPRQLLRRRKRPKRRLTTKLDLSPIKMSTSESSVLMNCCIEGTCQHDNNTARLARNEKIMSAKFDEEDGYTNTIDNIQVPPLDEVLAAIPLTFEHGRRTAKMIQTLISAGQNPPRCSVCKLPFNANNAEDIITHKMVHNNIEFLNSNKHDLSVITDPAWTRDVGSSHKITFCKFDEHASLTVREFAIDVVRNKVDRALGYVGYESNANAEAYELGRDMLSGVAKVYIAFVGPPGLKPALRAVGVVVVRRAMAASLYSRQDGQEKWTAQDHECDMIVDRIWVDEEYRKLVPMSDEPQHLATRLVDFARLNFYYGYTVAKEKTAFSQPTSSGYRFACRYFDGVWGPGELLAVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.27
4 0.31
5 0.32
6 0.32
7 0.34
8 0.41
9 0.46
10 0.48
11 0.55
12 0.61
13 0.7
14 0.79
15 0.84
16 0.86
17 0.87
18 0.88
19 0.87
20 0.81
21 0.81
22 0.81
23 0.81
24 0.82
25 0.8
26 0.78
27 0.75
28 0.73
29 0.72
30 0.73
31 0.73
32 0.73
33 0.73
34 0.7
35 0.7
36 0.69
37 0.59
38 0.54
39 0.51
40 0.45
41 0.39
42 0.39
43 0.34
44 0.36
45 0.37
46 0.4
47 0.44
48 0.45
49 0.49
50 0.51
51 0.56
52 0.54
53 0.58
54 0.5
55 0.42
56 0.39
57 0.34
58 0.33
59 0.29
60 0.32
61 0.27
62 0.33
63 0.32
64 0.32
65 0.34
66 0.28
67 0.31
68 0.37
69 0.41
70 0.35
71 0.34
72 0.35
73 0.32
74 0.35
75 0.32
76 0.23
77 0.19
78 0.21
79 0.23
80 0.22
81 0.22
82 0.17
83 0.19
84 0.25
85 0.28
86 0.28
87 0.28
88 0.33
89 0.34
90 0.34
91 0.37
92 0.36
93 0.41
94 0.41
95 0.43
96 0.41
97 0.43
98 0.52
99 0.57
100 0.6
101 0.6
102 0.68
103 0.72
104 0.79
105 0.84
106 0.85
107 0.86
108 0.88
109 0.91
110 0.92
111 0.94
112 0.94
113 0.95
114 0.95
115 0.95
116 0.94
117 0.92
118 0.91
119 0.89
120 0.84
121 0.79
122 0.69
123 0.61
124 0.55
125 0.46
126 0.37
127 0.28
128 0.24
129 0.18
130 0.2
131 0.18
132 0.14
133 0.15
134 0.15
135 0.15
136 0.14
137 0.13
138 0.1
139 0.09
140 0.08
141 0.07
142 0.07
143 0.13
144 0.18
145 0.2
146 0.21
147 0.27
148 0.28
149 0.3
150 0.33
151 0.3
152 0.25
153 0.27
154 0.3
155 0.25
156 0.29
157 0.28
158 0.24
159 0.28
160 0.28
161 0.28
162 0.27
163 0.26
164 0.21
165 0.21
166 0.2
167 0.15
168 0.16
169 0.14
170 0.13
171 0.12
172 0.12
173 0.11
174 0.11
175 0.1
176 0.09
177 0.08
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.08
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.04
190 0.04
191 0.03
192 0.07
193 0.07
194 0.07
195 0.09
196 0.14
197 0.15
198 0.16
199 0.21
200 0.23
201 0.25
202 0.29
203 0.28
204 0.24
205 0.24
206 0.23
207 0.2
208 0.15
209 0.13
210 0.1
211 0.14
212 0.18
213 0.18
214 0.19
215 0.2
216 0.21
217 0.23
218 0.3
219 0.31
220 0.34
221 0.35
222 0.4
223 0.43
224 0.45
225 0.46
226 0.38
227 0.33
228 0.27
229 0.25
230 0.18
231 0.16
232 0.15
233 0.11
234 0.11
235 0.12
236 0.14
237 0.14
238 0.17
239 0.16
240 0.14
241 0.14
242 0.16
243 0.16
244 0.14
245 0.2
246 0.18
247 0.19
248 0.18
249 0.18
250 0.15
251 0.15
252 0.18
253 0.14
254 0.14
255 0.13
256 0.14
257 0.14
258 0.15
259 0.16
260 0.11
261 0.1
262 0.11
263 0.12
264 0.14
265 0.18
266 0.19
267 0.19
268 0.23
269 0.23
270 0.22
271 0.25
272 0.24
273 0.25
274 0.23
275 0.24
276 0.24
277 0.26
278 0.28
279 0.25
280 0.24
281 0.2
282 0.21
283 0.19
284 0.15
285 0.12
286 0.1
287 0.12
288 0.14
289 0.15
290 0.16
291 0.18
292 0.18
293 0.18
294 0.2
295 0.18
296 0.14
297 0.17
298 0.16
299 0.15
300 0.15
301 0.16
302 0.14
303 0.13
304 0.13
305 0.09
306 0.07
307 0.08
308 0.07
309 0.06
310 0.06
311 0.07
312 0.07
313 0.08
314 0.07
315 0.06
316 0.06
317 0.06
318 0.06
319 0.07
320 0.07
321 0.06
322 0.06
323 0.06
324 0.06
325 0.07
326 0.07
327 0.05
328 0.05
329 0.05
330 0.05
331 0.08
332 0.08
333 0.09
334 0.11
335 0.13
336 0.13
337 0.14
338 0.17
339 0.18
340 0.18
341 0.18
342 0.15
343 0.19
344 0.2
345 0.2
346 0.17
347 0.14
348 0.13
349 0.13
350 0.13
351 0.07
352 0.06
353 0.07
354 0.09
355 0.14
356 0.16
357 0.16
358 0.17
359 0.18
360 0.22
361 0.21
362 0.24
363 0.27
364 0.27
365 0.29
366 0.34
367 0.36
368 0.33
369 0.38
370 0.34
371 0.28
372 0.27
373 0.25
374 0.21
375 0.19
376 0.18
377 0.14
378 0.12
379 0.1
380 0.11
381 0.11
382 0.11
383 0.15
384 0.17
385 0.2
386 0.21
387 0.22
388 0.21
389 0.22
390 0.24
391 0.25
392 0.28
393 0.28
394 0.3
395 0.31
396 0.34
397 0.33
398 0.3
399 0.26
400 0.22
401 0.19
402 0.2
403 0.18
404 0.19
405 0.18
406 0.19
407 0.24
408 0.23
409 0.23
410 0.2
411 0.2
412 0.19
413 0.19
414 0.21
415 0.16
416 0.19
417 0.19
418 0.22
419 0.22
420 0.21
421 0.26
422 0.32
423 0.32
424 0.32
425 0.38
426 0.36
427 0.41
428 0.46
429 0.41
430 0.38
431 0.37
432 0.4
433 0.37
434 0.38
435 0.35
436 0.31
437 0.33
438 0.29
439 0.33
440 0.3
441 0.29
442 0.28
443 0.25
444 0.24
445 0.21
446 0.2