Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X0S1

Protein Details
Accession K1X0S1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
108-134AVEAKREKKAARRREKREQAKTGEGRABasic
NLS Segment(s)
PositionSequence
110-130EAKREKKAARRREKREQAKTG
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mbe:MBM_03028  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSTPKVVASATRQINGVVVSAGLMQKTVKARVGVQKWNNVIKKKFNHSENLLVHDPASSLRVGDVISISPGWRYSKRVHHVVNSIVAPFGDPIESRPAVPTLEERIRAVEAKREKKAARRREKREQAKTGEGRAVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.21
4 0.12
5 0.08
6 0.07
7 0.08
8 0.09
9 0.07
10 0.07
11 0.07
12 0.1
13 0.14
14 0.16
15 0.17
16 0.18
17 0.23
18 0.31
19 0.37
20 0.43
21 0.44
22 0.48
23 0.5
24 0.57
25 0.58
26 0.57
27 0.55
28 0.54
29 0.57
30 0.59
31 0.62
32 0.56
33 0.57
34 0.54
35 0.59
36 0.51
37 0.51
38 0.43
39 0.36
40 0.32
41 0.26
42 0.22
43 0.13
44 0.13
45 0.07
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.09
59 0.1
60 0.13
61 0.18
62 0.27
63 0.32
64 0.39
65 0.4
66 0.42
67 0.44
68 0.42
69 0.4
70 0.32
71 0.27
72 0.2
73 0.17
74 0.13
75 0.1
76 0.08
77 0.06
78 0.05
79 0.07
80 0.12
81 0.13
82 0.13
83 0.14
84 0.15
85 0.15
86 0.16
87 0.16
88 0.18
89 0.22
90 0.23
91 0.22
92 0.23
93 0.25
94 0.26
95 0.25
96 0.27
97 0.32
98 0.39
99 0.43
100 0.48
101 0.5
102 0.57
103 0.66
104 0.69
105 0.71
106 0.74
107 0.79
108 0.83
109 0.9
110 0.91
111 0.92
112 0.9
113 0.86
114 0.86
115 0.82
116 0.75