Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9Y9V4

Protein Details
Accession A0A3M9Y9V4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-71VVVGEDGKRRRRRRRDNPPEIKDGIBasic
NLS Segment(s)
PositionSequence
54-62KRRRRRRRD
Subcellular Location(s) extr 13, mito 5, plas 4, E.R. 2, cyto 1, pero 1, golg 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRMTSSLFATTVVASFFVVGLPHILPCPAPRVAYADGEVVVGEDGKRRRRRRRDNPPEIKDGIVHFDQTPDAAAAVSCSKDDRASRECPVPRPGGMLGEWLGFHAEKKVDDRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.41
3 0.33
4 0.3
5 0.26
6 0.21
7 0.14
8 0.11
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.12
23 0.11
24 0.12
25 0.12
26 0.16
27 0.18
28 0.19
29 0.19
30 0.15
31 0.14
32 0.14
33 0.13
34 0.08
35 0.06
36 0.05
37 0.04
38 0.08
39 0.12
40 0.2
41 0.3
42 0.38
43 0.49
44 0.6
45 0.72
46 0.79
47 0.87
48 0.9
49 0.92
50 0.94
51 0.88
52 0.83
53 0.73
54 0.62
55 0.51
56 0.4
57 0.32
58 0.22
59 0.18
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.07
71 0.07
72 0.06
73 0.07
74 0.08
75 0.12
76 0.14
77 0.19
78 0.23
79 0.27
80 0.31
81 0.38
82 0.42
83 0.43
84 0.47
85 0.44
86 0.4
87 0.39
88 0.36
89 0.3
90 0.26
91 0.24
92 0.19
93 0.17
94 0.16
95 0.13
96 0.14
97 0.11
98 0.12
99 0.13
100 0.14
101 0.15
102 0.2