Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9XX90

Protein Details
Accession A0A3M9XX90    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-80VAVPNKQKTPRKKSTPKTAVAHydrophilic
113-139EEGSATKKKRTPKKTPAKKTPAKVEEEBasic
NLS Segment(s)
PositionSequence
98-133KRGGGAKKRASGADGEEGSATKKKRTPKKTPAKKTP
Subcellular Location(s) nucl 12.5, cyto_nucl 11.166, cyto 8.5, cyto_mito 7.333, mito 4
Family & Domain DBs
Amino Acid Sequences QQAIVLNNILGQLHASSGKSLDWTAISEALPGRTMASMRAVWDRYRNDMKTAAAGEGEFVAVPNKQKTPRKKSTPKTAVAVASEDADAEDVPETPAEKRGGGAKKRASGADGEEGSATKKKRTPKKTPAKKTPAKVEEEEEASEEAEPPTRTTADVEDAKNSDEDMKETAEAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.12
7 0.12
8 0.12
9 0.11
10 0.12
11 0.13
12 0.14
13 0.14
14 0.14
15 0.15
16 0.14
17 0.14
18 0.12
19 0.12
20 0.1
21 0.11
22 0.1
23 0.12
24 0.12
25 0.14
26 0.19
27 0.2
28 0.21
29 0.28
30 0.29
31 0.32
32 0.4
33 0.39
34 0.36
35 0.37
36 0.36
37 0.32
38 0.31
39 0.24
40 0.16
41 0.15
42 0.12
43 0.1
44 0.09
45 0.06
46 0.05
47 0.05
48 0.06
49 0.08
50 0.1
51 0.14
52 0.21
53 0.29
54 0.39
55 0.48
56 0.58
57 0.66
58 0.74
59 0.79
60 0.83
61 0.84
62 0.77
63 0.7
64 0.63
65 0.54
66 0.44
67 0.37
68 0.25
69 0.18
70 0.14
71 0.11
72 0.07
73 0.06
74 0.05
75 0.04
76 0.04
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.09
83 0.09
84 0.09
85 0.1
86 0.17
87 0.24
88 0.27
89 0.33
90 0.34
91 0.37
92 0.38
93 0.38
94 0.32
95 0.26
96 0.25
97 0.24
98 0.2
99 0.17
100 0.15
101 0.15
102 0.16
103 0.19
104 0.17
105 0.16
106 0.19
107 0.28
108 0.38
109 0.48
110 0.57
111 0.64
112 0.75
113 0.82
114 0.89
115 0.91
116 0.92
117 0.9
118 0.87
119 0.87
120 0.81
121 0.76
122 0.68
123 0.6
124 0.53
125 0.48
126 0.41
127 0.31
128 0.25
129 0.2
130 0.18
131 0.15
132 0.11
133 0.13
134 0.13
135 0.13
136 0.15
137 0.15
138 0.16
139 0.17
140 0.19
141 0.21
142 0.26
143 0.26
144 0.28
145 0.29
146 0.29
147 0.27
148 0.26
149 0.23
150 0.18
151 0.19
152 0.17
153 0.18
154 0.17