Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9YGF3

Protein Details
Accession A0A3M9YGF3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-61KDTPLPKPTKHNPPPRLASLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013650  ATP-grasp_succ-CoA_synth-type  
IPR032263  Citrate-bd  
IPR005809  Succ_CoA_synthase_bsu  
IPR016102  Succinyl-CoA_synth-like  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003878  F:ATP citrate synthase activity  
GO:0006099  P:tricarboxylic acid cycle  
Pfam View protein in Pfam  
PF08442  ATP-grasp_2  
PF16114  Citrate_bind  
Amino Acid Sequences MAGKFPPSSRFCRARAVASKSIFEADGKAILNYHLTRSPVVKDTPLPKPTKHNPPPRLASLHFPEDANVNDILDQAEVTYPWLLQSGAKFVAKPDQLIKRRGKSGLLALNKTWPEAKAWVAERAGKEQQVEHVTGVLRQFLVEPFVPHPQDTEYYINIMSVREGDWILFTHEGGVDVGDVDEKAEKILIPVDLSEYPSNEEIASTLLKKVPKGVHNVLVDFISRLYAVYVECNFTYLEINPLVVIPNEDATSATVHFLDLAAKIDQTADFECGVKWAIARSPAALGLTNVAGGEKVNIDAGPPLDFPAPFGRELTKEEAYIADLDAKTGASLKLTVLNATGRIWTLVAGGGASVVYADAIASAGFADQLANYGEYSGAPTESQTYHYARTVLDLMLRAPVAKEGKVLFIGGGIANFTNVASTFKGVIRALREFATTLNEHNVQIWVRRAGPNYQEGLKNMKAATQELGLNAKIFGPEMHVSGIVPLALIPGKWEASGAKEFVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.66
4 0.65
5 0.61
6 0.6
7 0.51
8 0.5
9 0.4
10 0.32
11 0.26
12 0.19
13 0.2
14 0.19
15 0.17
16 0.16
17 0.16
18 0.21
19 0.19
20 0.22
21 0.21
22 0.22
23 0.24
24 0.26
25 0.3
26 0.3
27 0.31
28 0.31
29 0.35
30 0.4
31 0.47
32 0.52
33 0.52
34 0.5
35 0.58
36 0.63
37 0.68
38 0.71
39 0.73
40 0.73
41 0.78
42 0.82
43 0.78
44 0.76
45 0.66
46 0.64
47 0.59
48 0.56
49 0.48
50 0.41
51 0.35
52 0.31
53 0.3
54 0.24
55 0.18
56 0.14
57 0.12
58 0.13
59 0.13
60 0.1
61 0.08
62 0.06
63 0.07
64 0.06
65 0.08
66 0.08
67 0.07
68 0.07
69 0.08
70 0.08
71 0.09
72 0.11
73 0.14
74 0.17
75 0.18
76 0.17
77 0.18
78 0.26
79 0.25
80 0.26
81 0.29
82 0.36
83 0.41
84 0.5
85 0.57
86 0.56
87 0.6
88 0.6
89 0.55
90 0.48
91 0.5
92 0.5
93 0.48
94 0.44
95 0.39
96 0.43
97 0.41
98 0.39
99 0.32
100 0.24
101 0.21
102 0.21
103 0.22
104 0.21
105 0.23
106 0.26
107 0.26
108 0.3
109 0.29
110 0.32
111 0.34
112 0.29
113 0.28
114 0.24
115 0.28
116 0.27
117 0.27
118 0.21
119 0.21
120 0.19
121 0.2
122 0.2
123 0.15
124 0.12
125 0.11
126 0.12
127 0.09
128 0.12
129 0.11
130 0.13
131 0.14
132 0.2
133 0.2
134 0.19
135 0.2
136 0.19
137 0.2
138 0.22
139 0.22
140 0.17
141 0.18
142 0.17
143 0.17
144 0.16
145 0.14
146 0.1
147 0.08
148 0.08
149 0.08
150 0.08
151 0.07
152 0.07
153 0.08
154 0.1
155 0.09
156 0.09
157 0.08
158 0.08
159 0.09
160 0.08
161 0.07
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.07
175 0.07
176 0.06
177 0.07
178 0.09
179 0.09
180 0.12
181 0.12
182 0.11
183 0.13
184 0.13
185 0.13
186 0.1
187 0.1
188 0.07
189 0.08
190 0.09
191 0.07
192 0.08
193 0.11
194 0.12
195 0.12
196 0.18
197 0.21
198 0.24
199 0.31
200 0.33
201 0.37
202 0.37
203 0.38
204 0.33
205 0.28
206 0.24
207 0.17
208 0.14
209 0.07
210 0.06
211 0.05
212 0.05
213 0.05
214 0.05
215 0.07
216 0.08
217 0.09
218 0.08
219 0.09
220 0.09
221 0.09
222 0.1
223 0.08
224 0.09
225 0.08
226 0.08
227 0.07
228 0.08
229 0.07
230 0.06
231 0.07
232 0.05
233 0.05
234 0.05
235 0.06
236 0.06
237 0.06
238 0.07
239 0.06
240 0.06
241 0.06
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.07
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.08
255 0.07
256 0.07
257 0.08
258 0.08
259 0.08
260 0.09
261 0.07
262 0.07
263 0.06
264 0.07
265 0.09
266 0.09
267 0.09
268 0.09
269 0.1
270 0.1
271 0.09
272 0.08
273 0.07
274 0.07
275 0.06
276 0.05
277 0.05
278 0.04
279 0.04
280 0.05
281 0.04
282 0.04
283 0.04
284 0.04
285 0.05
286 0.06
287 0.06
288 0.07
289 0.07
290 0.08
291 0.09
292 0.08
293 0.1
294 0.14
295 0.15
296 0.14
297 0.15
298 0.15
299 0.16
300 0.19
301 0.23
302 0.19
303 0.18
304 0.18
305 0.17
306 0.16
307 0.15
308 0.12
309 0.11
310 0.1
311 0.1
312 0.1
313 0.09
314 0.08
315 0.09
316 0.09
317 0.05
318 0.06
319 0.07
320 0.11
321 0.12
322 0.12
323 0.12
324 0.13
325 0.13
326 0.13
327 0.13
328 0.08
329 0.09
330 0.08
331 0.07
332 0.07
333 0.06
334 0.06
335 0.05
336 0.05
337 0.04
338 0.04
339 0.04
340 0.03
341 0.02
342 0.02
343 0.02
344 0.02
345 0.02
346 0.02
347 0.02
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.04
356 0.05
357 0.06
358 0.06
359 0.06
360 0.06
361 0.06
362 0.08
363 0.07
364 0.07
365 0.07
366 0.07
367 0.1
368 0.11
369 0.14
370 0.16
371 0.18
372 0.2
373 0.21
374 0.22
375 0.19
376 0.21
377 0.2
378 0.17
379 0.16
380 0.15
381 0.14
382 0.14
383 0.14
384 0.12
385 0.1
386 0.15
387 0.15
388 0.15
389 0.17
390 0.16
391 0.18
392 0.18
393 0.18
394 0.13
395 0.11
396 0.12
397 0.09
398 0.08
399 0.07
400 0.06
401 0.06
402 0.06
403 0.06
404 0.06
405 0.06
406 0.08
407 0.08
408 0.1
409 0.12
410 0.13
411 0.17
412 0.17
413 0.2
414 0.23
415 0.25
416 0.25
417 0.24
418 0.24
419 0.21
420 0.21
421 0.23
422 0.19
423 0.19
424 0.22
425 0.23
426 0.22
427 0.23
428 0.25
429 0.21
430 0.24
431 0.26
432 0.24
433 0.26
434 0.3
435 0.32
436 0.35
437 0.38
438 0.4
439 0.39
440 0.4
441 0.4
442 0.38
443 0.42
444 0.38
445 0.37
446 0.31
447 0.3
448 0.28
449 0.26
450 0.26
451 0.22
452 0.22
453 0.2
454 0.23
455 0.21
456 0.19
457 0.18
458 0.16
459 0.14
460 0.13
461 0.11
462 0.14
463 0.15
464 0.15
465 0.16
466 0.16
467 0.15
468 0.16
469 0.16
470 0.1
471 0.09
472 0.07
473 0.08
474 0.08
475 0.08
476 0.09
477 0.12
478 0.12
479 0.12
480 0.14
481 0.13
482 0.18
483 0.22