Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9Y256

Protein Details
Accession A0A3M9Y256    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
90-115APTGKPKQTTKKQSKVNKPQKAKANSHydrophilic
NLS Segment(s)
PositionSequence
87-113SRPAPTGKPKQTTKKQSKVNKPQKAKA
148-166KGKKADKSEKGLNKGGSRR
Subcellular Location(s) mito 13, cyto 9, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MSHFQPPAENQHGYFKSLWVVEALLCSAASRGFPVTITRASAMTNLRYGSLTSTGDEFALRIILAMVDSGMIPTARKMAQGAIKSSSRPAPTGKPKQTTKKQSKVNKPQKAKANSAADKLQKKYCAGLITKTEKMLGERAGHLELIGKGKKADKSEKGLNKGGSRRYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.28
4 0.26
5 0.25
6 0.16
7 0.15
8 0.12
9 0.12
10 0.12
11 0.08
12 0.08
13 0.08
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.09
21 0.11
22 0.14
23 0.15
24 0.16
25 0.16
26 0.15
27 0.15
28 0.18
29 0.18
30 0.17
31 0.17
32 0.16
33 0.16
34 0.16
35 0.16
36 0.14
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.12
43 0.11
44 0.09
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.06
62 0.06
63 0.06
64 0.07
65 0.1
66 0.14
67 0.16
68 0.17
69 0.18
70 0.19
71 0.19
72 0.2
73 0.21
74 0.17
75 0.17
76 0.18
77 0.23
78 0.32
79 0.42
80 0.47
81 0.51
82 0.56
83 0.65
84 0.72
85 0.75
86 0.75
87 0.74
88 0.77
89 0.79
90 0.84
91 0.85
92 0.87
93 0.86
94 0.83
95 0.81
96 0.82
97 0.78
98 0.72
99 0.69
100 0.68
101 0.61
102 0.57
103 0.56
104 0.53
105 0.52
106 0.51
107 0.46
108 0.4
109 0.38
110 0.37
111 0.34
112 0.33
113 0.29
114 0.31
115 0.34
116 0.37
117 0.38
118 0.36
119 0.34
120 0.3
121 0.3
122 0.28
123 0.24
124 0.21
125 0.21
126 0.23
127 0.23
128 0.21
129 0.19
130 0.19
131 0.17
132 0.21
133 0.21
134 0.2
135 0.21
136 0.26
137 0.31
138 0.35
139 0.42
140 0.43
141 0.49
142 0.58
143 0.65
144 0.66
145 0.69
146 0.68
147 0.66
148 0.67