Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9YGX7

Protein Details
Accession A0A3M9YGX7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
133-155DEFSKSAKLRRKAAKRKAKLLAEHydrophilic
192-216REELRQAMRSERKRKIKESNYLKSMHydrophilic
NLS Segment(s)
PositionSequence
138-151SAKLRRKAAKRKAK
202-206ERKRK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MICRTCLRRAATTLPLRTVAPIPFARPFSISASTRSSPAGSLGTSEASPASSTAEPTATPTLSTPIDLPSAAAAKPVREPSSCQAGTVLNGLNYFKGKTDPVALADEEYPDWLWDCLVFKAKEDAGADAEAADEFSKSAKLRRKAAKRKAKLLAEGGIDALAPKVPLYQQSINLPGEEGGSVEDNLMAAGKREELRQAMRSERKRKIKESNYLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.42
4 0.4
5 0.37
6 0.29
7 0.27
8 0.24
9 0.25
10 0.28
11 0.3
12 0.29
13 0.27
14 0.28
15 0.26
16 0.32
17 0.29
18 0.28
19 0.33
20 0.32
21 0.32
22 0.31
23 0.27
24 0.2
25 0.21
26 0.19
27 0.12
28 0.13
29 0.13
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.09
36 0.08
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.14
44 0.16
45 0.12
46 0.12
47 0.12
48 0.14
49 0.14
50 0.15
51 0.12
52 0.11
53 0.12
54 0.11
55 0.11
56 0.09
57 0.1
58 0.09
59 0.12
60 0.11
61 0.11
62 0.14
63 0.17
64 0.19
65 0.18
66 0.22
67 0.22
68 0.31
69 0.3
70 0.27
71 0.25
72 0.23
73 0.23
74 0.21
75 0.18
76 0.09
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.07
83 0.08
84 0.08
85 0.09
86 0.11
87 0.11
88 0.12
89 0.13
90 0.13
91 0.12
92 0.12
93 0.12
94 0.09
95 0.09
96 0.07
97 0.05
98 0.06
99 0.05
100 0.04
101 0.05
102 0.06
103 0.07
104 0.12
105 0.12
106 0.12
107 0.15
108 0.15
109 0.17
110 0.16
111 0.16
112 0.12
113 0.12
114 0.11
115 0.09
116 0.09
117 0.06
118 0.06
119 0.05
120 0.03
121 0.03
122 0.04
123 0.06
124 0.07
125 0.13
126 0.21
127 0.27
128 0.36
129 0.46
130 0.56
131 0.65
132 0.75
133 0.8
134 0.79
135 0.83
136 0.83
137 0.77
138 0.71
139 0.63
140 0.57
141 0.47
142 0.4
143 0.31
144 0.22
145 0.17
146 0.13
147 0.1
148 0.06
149 0.04
150 0.04
151 0.05
152 0.06
153 0.09
154 0.16
155 0.18
156 0.22
157 0.25
158 0.3
159 0.29
160 0.29
161 0.26
162 0.2
163 0.18
164 0.14
165 0.11
166 0.08
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.07
177 0.1
178 0.12
179 0.13
180 0.17
181 0.21
182 0.26
183 0.31
184 0.34
185 0.41
186 0.5
187 0.59
188 0.65
189 0.7
190 0.76
191 0.78
192 0.83
193 0.84
194 0.84
195 0.85
196 0.86