Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9XVQ6

Protein Details
Accession A0A3M9XVQ6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-61GPSSKKPQKKMPPPEIPRSSHydrophilic
NLS Segment(s)
PositionSequence
45-66SKKPQKKMPPPEIPRSSPPKHK
Subcellular Location(s) cyto 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Amino Acid Sequences GNPFRTDFGKGTAAAEFLAEPPFLNLGAALDGVPEEDKWAAGPSSKKPQKKMPPPEIPRSSPPKHKPEQLRDLRVGIIGAGFTGLLLAHGLRRHGGVEVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.11
4 0.09
5 0.1
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.06
13 0.05
14 0.06
15 0.06
16 0.05
17 0.04
18 0.04
19 0.05
20 0.05
21 0.04
22 0.05
23 0.05
24 0.05
25 0.05
26 0.07
27 0.06
28 0.09
29 0.12
30 0.15
31 0.26
32 0.32
33 0.36
34 0.39
35 0.48
36 0.56
37 0.63
38 0.69
39 0.68
40 0.73
41 0.75
42 0.81
43 0.76
44 0.69
45 0.65
46 0.63
47 0.58
48 0.57
49 0.59
50 0.58
51 0.57
52 0.62
53 0.65
54 0.66
55 0.73
56 0.72
57 0.7
58 0.64
59 0.61
60 0.53
61 0.44
62 0.35
63 0.24
64 0.15
65 0.09
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.07
76 0.08
77 0.1
78 0.11
79 0.12
80 0.12
81 0.14