Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WGM9

Protein Details
Accession K1WGM9   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-85RACMDTPRPKSQKKNTINHHLSRHydrophilic
NLS Segment(s)
PositionSequence
94-97RKRK
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG mbe:MBM_09800  -  
Amino Acid Sequences MPPKGSSTALQPMRLPPLPKLRVRRPNRADANPCLSIMSSVLTCWASSGHTVAGCQALETQLRACMDTPRPKSQKKNTINHHLSRMYPNIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.35
4 0.42
5 0.46
6 0.51
7 0.57
8 0.6
9 0.67
10 0.72
11 0.77
12 0.73
13 0.77
14 0.78
15 0.78
16 0.73
17 0.68
18 0.67
19 0.57
20 0.51
21 0.41
22 0.32
23 0.24
24 0.18
25 0.13
26 0.07
27 0.06
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.09
49 0.1
50 0.1
51 0.11
52 0.15
53 0.22
54 0.3
55 0.36
56 0.43
57 0.5
58 0.57
59 0.66
60 0.72
61 0.75
62 0.76
63 0.8
64 0.79
65 0.83
66 0.84
67 0.79
68 0.76
69 0.68
70 0.61
71 0.57
72 0.52
73 0.44
74 0.37
75 0.35
76 0.38
77 0.43