Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M9Y341

Protein Details
Accession A0A3M9Y341    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-119GDSEKKRKRATPKKKVMAEGBasic
129-148IETPIKKKRAPANKKASVKPHydrophilic
NLS Segment(s)
PositionSequence
103-114EKKRKRATPKKK
134-145KKKRAPANKKAS
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MSDNDSNSGQGGTSLPAASNAAPTKMQLSDREQEILSKAWSCMKVQPEIDHVRLAAATGMTNPRSAANAWGALKKKLFVGTAAATPIKARAAAAANNEGGDSEKKRKRATPKKKVMAEGDEDDGDAAPIETPIKKKRAPANKKASVKPAANEAPVSANAAVTDSEATLADMDEGEAKVEHQSGDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.11
6 0.16
7 0.15
8 0.16
9 0.16
10 0.16
11 0.18
12 0.2
13 0.22
14 0.21
15 0.26
16 0.29
17 0.31
18 0.33
19 0.3
20 0.29
21 0.28
22 0.25
23 0.21
24 0.17
25 0.16
26 0.19
27 0.2
28 0.21
29 0.24
30 0.25
31 0.29
32 0.29
33 0.31
34 0.32
35 0.36
36 0.36
37 0.31
38 0.28
39 0.23
40 0.21
41 0.19
42 0.12
43 0.07
44 0.06
45 0.07
46 0.1
47 0.1
48 0.1
49 0.11
50 0.1
51 0.11
52 0.12
53 0.12
54 0.11
55 0.14
56 0.15
57 0.19
58 0.2
59 0.21
60 0.21
61 0.2
62 0.19
63 0.18
64 0.17
65 0.13
66 0.15
67 0.14
68 0.14
69 0.15
70 0.14
71 0.11
72 0.11
73 0.11
74 0.08
75 0.07
76 0.06
77 0.06
78 0.08
79 0.1
80 0.11
81 0.12
82 0.12
83 0.12
84 0.12
85 0.1
86 0.09
87 0.09
88 0.11
89 0.18
90 0.22
91 0.26
92 0.29
93 0.35
94 0.45
95 0.55
96 0.63
97 0.66
98 0.73
99 0.78
100 0.8
101 0.79
102 0.72
103 0.65
104 0.58
105 0.49
106 0.4
107 0.3
108 0.26
109 0.21
110 0.16
111 0.12
112 0.08
113 0.05
114 0.03
115 0.04
116 0.05
117 0.07
118 0.12
119 0.18
120 0.23
121 0.25
122 0.32
123 0.42
124 0.52
125 0.6
126 0.66
127 0.71
128 0.75
129 0.81
130 0.78
131 0.77
132 0.73
133 0.66
134 0.57
135 0.54
136 0.48
137 0.42
138 0.37
139 0.31
140 0.26
141 0.23
142 0.25
143 0.16
144 0.13
145 0.11
146 0.12
147 0.11
148 0.09
149 0.09
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.08
160 0.08
161 0.08
162 0.08
163 0.09
164 0.1
165 0.11
166 0.11