Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9Y0M1

Protein Details
Accession A0A3M9Y0M1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRERLRAVDSVHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
28-31KRRH
84-95KEKRYRKGIHKL
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRMTSPLSGGLLWKIPWRLSKFQKRRHRERLRAVDSVIATVDAALARHGATIAAVEQWKAEMPTEQEMLPKDKYTMFDRKEKRYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.17
6 0.19
7 0.26
8 0.31
9 0.38
10 0.47
11 0.57
12 0.63
13 0.72
14 0.8
15 0.82
16 0.87
17 0.9
18 0.9
19 0.89
20 0.9
21 0.9
22 0.85
23 0.78
24 0.68
25 0.6
26 0.49
27 0.39
28 0.28
29 0.17
30 0.11
31 0.08
32 0.08
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.08
54 0.11
55 0.12
56 0.12
57 0.14
58 0.15
59 0.19
60 0.19
61 0.17
62 0.16
63 0.17
64 0.2
65 0.24
66 0.31
67 0.31
68 0.4
69 0.46
70 0.55
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79