FuNGI

A0A3M9Y7A0

Protein Details

Accession

A0A3M9Y7A0

Localization Confidence

Low

Confidence Score

9.7

NoLS Segment(s)

Position	Sequence	Protein Nature
217-243	PTNSTPRRPTENKQRRRRPSTPPPANV	Hydrophilic

NLS Segment(s)

Position	Sequence
223-235	RRPTENKQRRRRP

Subcellular Location(s)

mito 8, extr 7, nucl 5, cyto 5, cyto_nucl 5

Family & Domain DBs

InterPro	View protein in InterPro IPR019383 Golgin_A_7/ERF4
Gene Ontology	GO:0005789 C:endoplasmic reticulum membrane
Pfam	View protein in Pfam PF10256 Erf4

Amino Acid Sequences

MLGLDALAARPLSAVPLIQPRSRPCHCNGDGRCTETAAPAWTPVSAPAPATTPTAATAVAAAAPTTTAAPAPAAAVAAAPASSSSPNLVTRALITNGPSCRASLRRDRLFGGSPPLAFPTASHARQVPDPIPSSTIDAFANPRLTTLSHRQPPVYPGASTLPSPPAPTAPVHRRFESTRGAAYIPHEPFVQSPFLSKASATPRRLRRLSGAARLWNPTNSTPRRPTENKQRRRRPSTPPPANVPLSHPALDNSTDPADPVSTGAGHYPLLTLPELRQSRRSGSGRGSLQFDHRGNSDHRISLPRSVRHSYDEKRGATSSNPSPVDPEQASPGSLQPQEVDKGKGKAIMTPQPDEQQRGYSRDLERGPDIMDPRRHSNLSAGDGIGSAMSSDSSIMGEEVGDMGEEWGPQHPCYPHLNPHVPVDSPEYQNTRIIRVRRDWLIEGDLAPTFSNLYPEILDPAGLSEQEFRRVIEKLNGELIPIFNPYDWRNIVDSMLGLVTGWLWDDFGLTGVKARLTRLENWMDQWNKEIEKTAGAYEGASAPKLIPLRRTGYMTLDIQISDPEVAAAPSTPGASATGVMPMEPPTAVTA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.09
2	0.12
3	0.21
4	0.26
5	0.29
6	0.35
7	0.39
8	0.48
9	0.52
10	0.54
11	0.5
12	0.57
13	0.57
14	0.62
15	0.6
16	0.62
17	0.61
18	0.6
19	0.56
20	0.47
21	0.44
22	0.36
23	0.33
24	0.26
25	0.22
26	0.19
27	0.19
28	0.17
29	0.17
30	0.16
31	0.17
32	0.14
33	0.15
34	0.14
35	0.16
36	0.17
37	0.19
38	0.17
39	0.15
40	0.15
41	0.15
42	0.14
43	0.11
44	0.1
45	0.08
46	0.08
47	0.08
48	0.06
49	0.05
50	0.05
51	0.06
52	0.06
53	0.06
54	0.05
55	0.06
56	0.06
57	0.06
58	0.07
59	0.07
60	0.06
61	0.06
62	0.06
63	0.05
64	0.05
65	0.05
66	0.04
67	0.04
68	0.06
69	0.06
70	0.07
71	0.08
72	0.11
73	0.13
74	0.14
75	0.15
76	0.14
77	0.16
78	0.19
79	0.19
80	0.18
81	0.19
82	0.23
83	0.24
84	0.26
85	0.24
86	0.21
87	0.24
88	0.27
89	0.31
90	0.36
91	0.45
92	0.49
93	0.52
94	0.54
95	0.53
96	0.53
97	0.49
98	0.46
99	0.38
100	0.32
101	0.3
102	0.29
103	0.25
104	0.21
105	0.18
106	0.19
107	0.24
108	0.24
109	0.25
110	0.25
111	0.27
112	0.29
113	0.33
114	0.27
115	0.25
116	0.27
117	0.26
118	0.26
119	0.24
120	0.26
121	0.22
122	0.22
123	0.17
124	0.16
125	0.17
126	0.18
127	0.21
128	0.17
129	0.16
130	0.16
131	0.17
132	0.21
133	0.27
134	0.34
135	0.37
136	0.39
137	0.4
138	0.41
139	0.43
140	0.44
141	0.38
142	0.29
143	0.25
144	0.27
145	0.26
146	0.25
147	0.24
148	0.2
149	0.18
150	0.2
151	0.18
152	0.16
153	0.16
154	0.17
155	0.24
156	0.29
157	0.38
158	0.41
159	0.42
160	0.45
161	0.45
162	0.48
163	0.47
164	0.4
165	0.33
166	0.31
167	0.29
168	0.27
169	0.26
170	0.29
171	0.23
172	0.22
173	0.2
174	0.18
175	0.19
176	0.2
177	0.2
178	0.12
179	0.13
180	0.14
181	0.15
182	0.15
183	0.15
184	0.17
185	0.25
186	0.33
187	0.36
188	0.42
189	0.49
190	0.57
191	0.59
192	0.56
193	0.52
194	0.53
195	0.54
196	0.54
197	0.51
198	0.47
199	0.48
200	0.48
201	0.44
202	0.36
203	0.33
204	0.28
205	0.33
206	0.32
207	0.37
208	0.41
209	0.42
210	0.49
211	0.52
212	0.56
213	0.59
214	0.65
215	0.69
216	0.74
217	0.81
218	0.83
219	0.87
220	0.86
221	0.85
222	0.85
223	0.86
224	0.85
225	0.78
226	0.74
227	0.7
228	0.65
229	0.55
230	0.47
231	0.4
232	0.33
233	0.3
234	0.23
235	0.19
236	0.18
237	0.19
238	0.16
239	0.13
240	0.12
241	0.11
242	0.11
243	0.1
244	0.09
245	0.08
246	0.07
247	0.06
248	0.05
249	0.05
250	0.05
251	0.06
252	0.06
253	0.06
254	0.06
255	0.05
256	0.06
257	0.06
258	0.07
259	0.06
260	0.14
261	0.17
262	0.17
263	0.22
264	0.22
265	0.25
266	0.32
267	0.34
268	0.29
269	0.3
270	0.35
271	0.34
272	0.34
273	0.33
274	0.26
275	0.27
276	0.3
277	0.27
278	0.22
279	0.2
280	0.21
281	0.2
282	0.24
283	0.23
284	0.18
285	0.19
286	0.21
287	0.22
288	0.26
289	0.31
290	0.3
291	0.33
292	0.34
293	0.34
294	0.35
295	0.41
296	0.37
297	0.4
298	0.43
299	0.38
300	0.38
301	0.37
302	0.34
303	0.28
304	0.3
305	0.24
306	0.24
307	0.24
308	0.22
309	0.25
310	0.24
311	0.27
312	0.22
313	0.2
314	0.16
315	0.16
316	0.16
317	0.14
318	0.14
319	0.13
320	0.13
321	0.13
322	0.11
323	0.12
324	0.14
325	0.15
326	0.18
327	0.17
328	0.19
329	0.19
330	0.22
331	0.21
332	0.22
333	0.25
334	0.28
335	0.28
336	0.29
337	0.29
338	0.31
339	0.32
340	0.32
341	0.28
342	0.28
343	0.28
344	0.29
345	0.3
346	0.31
347	0.31
348	0.34
349	0.34
350	0.3
351	0.29
352	0.26
353	0.25
354	0.21
355	0.23
356	0.23
357	0.27
358	0.28
359	0.32
360	0.35
361	0.34
362	0.32
363	0.34
364	0.31
365	0.29
366	0.27
367	0.22
368	0.18
369	0.18
370	0.17
371	0.12
372	0.08
373	0.04
374	0.03
375	0.03
376	0.03
377	0.03
378	0.03
379	0.04
380	0.04
381	0.04
382	0.04
383	0.04
384	0.04
385	0.04
386	0.03
387	0.03
388	0.03
389	0.04
390	0.04
391	0.04
392	0.05
393	0.09
394	0.1
395	0.1
396	0.14
397	0.15
398	0.18
399	0.24
400	0.28
401	0.31
402	0.38
403	0.44
404	0.42
405	0.45
406	0.44
407	0.38
408	0.36
409	0.35
410	0.31
411	0.28
412	0.3
413	0.29
414	0.29
415	0.33
416	0.32
417	0.31
418	0.32
419	0.34
420	0.36
421	0.38
422	0.42
423	0.41
424	0.44
425	0.4
426	0.38
427	0.36
428	0.31
429	0.26
430	0.23
431	0.19
432	0.15
433	0.13
434	0.11
435	0.1
436	0.09
437	0.1
438	0.09
439	0.1
440	0.1
441	0.11
442	0.13
443	0.11
444	0.11
445	0.09
446	0.1
447	0.1
448	0.09
449	0.09
450	0.13
451	0.14
452	0.19
453	0.2
454	0.19
455	0.21
456	0.22
457	0.24
458	0.26
459	0.27
460	0.24
461	0.29
462	0.28
463	0.26
464	0.26
465	0.24
466	0.18
467	0.17
468	0.15
469	0.1
470	0.14
471	0.14
472	0.2
473	0.2
474	0.21
475	0.22
476	0.23
477	0.23
478	0.2
479	0.19
480	0.13
481	0.12
482	0.09
483	0.07
484	0.06
485	0.05
486	0.05
487	0.05
488	0.04
489	0.04
490	0.04
491	0.05
492	0.05
493	0.07
494	0.07
495	0.06
496	0.09
497	0.1
498	0.13
499	0.13
500	0.15
501	0.2
502	0.23
503	0.27
504	0.32
505	0.37
506	0.36
507	0.39
508	0.47
509	0.43
510	0.4
511	0.4
512	0.37
513	0.33
514	0.32
515	0.32
516	0.25
517	0.25
518	0.26
519	0.23
520	0.2
521	0.19
522	0.18
523	0.15
524	0.18
525	0.15
526	0.14
527	0.13
528	0.12
529	0.16
530	0.2
531	0.21
532	0.22
533	0.27
534	0.32
535	0.35
536	0.39
537	0.37
538	0.38
539	0.41
540	0.38
541	0.34
542	0.3
543	0.26
544	0.22
545	0.21
546	0.17
547	0.13
548	0.11
549	0.09
550	0.09
551	0.08
552	0.08
553	0.08
554	0.08
555	0.08
556	0.09
557	0.08
558	0.08
559	0.1
560	0.1
561	0.1
562	0.09
563	0.13
564	0.12
565	0.12
566	0.13
567	0.13
568	0.14
569	0.13

A0A3M9Y7A0

3D AlphaFold-predicted Structure Viewer