Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9XY49

Protein Details
Accession A0A3M9XY49   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-103RDFRHHHSRLARSPRHKTRNLKDVDBasic
NLS Segment(s)
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTMSILAIIVLLLSWIVSVWAYLSLTNILIPLVLEASLRLIQRTYWPIVRAFALAVGFLFSCTFRLMLFFTIDIHTAVRDFRHHHSRLARSPRHKTRNLKDVDIRDSAAVAEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.03
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.06
10 0.07
11 0.07
12 0.08
13 0.08
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.06
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.13
30 0.17
31 0.18
32 0.17
33 0.19
34 0.19
35 0.2
36 0.2
37 0.17
38 0.13
39 0.11
40 0.09
41 0.07
42 0.06
43 0.05
44 0.05
45 0.04
46 0.05
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.08
55 0.09
56 0.08
57 0.09
58 0.09
59 0.1
60 0.09
61 0.09
62 0.08
63 0.07
64 0.08
65 0.08
66 0.1
67 0.14
68 0.2
69 0.29
70 0.31
71 0.36
72 0.44
73 0.51
74 0.57
75 0.64
76 0.67
77 0.66
78 0.76
79 0.8
80 0.81
81 0.82
82 0.83
83 0.82
84 0.83
85 0.8
86 0.77
87 0.74
88 0.72
89 0.68
90 0.6
91 0.52
92 0.43
93 0.37