Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M9Y826

Protein Details
Accession A0A3M9Y826    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26SSQHNQSRKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
14-63RKAHRNGIKKPKTARYPSLKGTDPKFRRNHRHALHGTARALKEKREADKA
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKPKTARYPSLKGTDPKFRRNHRHALHGTARALKEKREADKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.79
6 0.8
7 0.83
8 0.8
9 0.77
10 0.76
11 0.76
12 0.76
13 0.72
14 0.7
15 0.68
16 0.64
17 0.62
18 0.6
19 0.55
20 0.5
21 0.48
22 0.5
23 0.45
24 0.49
25 0.53
26 0.57
27 0.64
28 0.67
29 0.73
30 0.66
31 0.72
32 0.66
33 0.66
34 0.64
35 0.59
36 0.56
37 0.51
38 0.49
39 0.47
40 0.45
41 0.4
42 0.42
43 0.43