Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M9Y9H0

Protein Details
Accession A0A3M9Y9H0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GDSTLIPPRKQERKHFKPTSRPRPPVPGQHydrophilic
NLS Segment(s)
PositionSequence
14-27KQERKHFKPTSRPR
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 10.333, cyto 5.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010997  HRDC-like_sf  
IPR006590  RNA_pol_Rpb4/RPC9_core  
IPR045222  Rpb4-like  
IPR005574  Rpb4/RPC9  
IPR038324  Rpb4/RPC9_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005634  C:nucleus  
GO:0000166  F:nucleotide binding  
GO:0006352  P:DNA-templated transcription initiation  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF03874  RNA_pol_Rpb4  
Amino Acid Sequences MADQGDSTLIPPRKQERKHFKPTSRPRPPVPGQEKAEAVLELGEFQEVDTLTLSEASLVINALVTKRRMDRKNVNETEMLTQTLNYLDAFSRFRQKENVEAVERLLSAHKQLAKFERAQIGSLCCETAEEAKTLIPSLQDKITDEDLQELLDEISKLQSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.64
3 0.66
4 0.72
5 0.82
6 0.86
7 0.86
8 0.87
9 0.91
10 0.91
11 0.91
12 0.87
13 0.81
14 0.81
15 0.78
16 0.77
17 0.73
18 0.71
19 0.64
20 0.61
21 0.57
22 0.48
23 0.43
24 0.32
25 0.25
26 0.16
27 0.11
28 0.08
29 0.07
30 0.06
31 0.05
32 0.04
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.04
48 0.04
49 0.05
50 0.07
51 0.08
52 0.1
53 0.15
54 0.24
55 0.27
56 0.35
57 0.44
58 0.5
59 0.6
60 0.6
61 0.57
62 0.5
63 0.48
64 0.43
65 0.34
66 0.26
67 0.15
68 0.13
69 0.11
70 0.1
71 0.09
72 0.06
73 0.06
74 0.05
75 0.07
76 0.09
77 0.1
78 0.19
79 0.19
80 0.21
81 0.25
82 0.26
83 0.31
84 0.35
85 0.38
86 0.32
87 0.32
88 0.31
89 0.27
90 0.25
91 0.19
92 0.15
93 0.1
94 0.09
95 0.13
96 0.15
97 0.15
98 0.19
99 0.24
100 0.27
101 0.28
102 0.31
103 0.34
104 0.31
105 0.32
106 0.3
107 0.27
108 0.25
109 0.24
110 0.2
111 0.13
112 0.13
113 0.12
114 0.14
115 0.13
116 0.11
117 0.12
118 0.12
119 0.13
120 0.13
121 0.13
122 0.12
123 0.13
124 0.15
125 0.17
126 0.18
127 0.19
128 0.23
129 0.27
130 0.25
131 0.24
132 0.24
133 0.21
134 0.2
135 0.18
136 0.15
137 0.1
138 0.11
139 0.11
140 0.08