Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GB06

Protein Details
Accession A0A397GB06    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-81LDEKNSRWQSKKKSRVGKKMHydrophilic
NLS Segment(s)
PositionSequence
71-81SKKKSRVGKKM
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MIEHEKIKQYVESIQVICAFDRNALELEKLVEKELADEISSYQSQILSVWTEGLVKYFNNALDEKNSRWQSKKKSRVGKKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.24
5 0.21
6 0.16
7 0.13
8 0.13
9 0.13
10 0.11
11 0.11
12 0.11
13 0.1
14 0.12
15 0.13
16 0.13
17 0.12
18 0.11
19 0.1
20 0.11
21 0.11
22 0.1
23 0.07
24 0.07
25 0.07
26 0.09
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.09
45 0.1
46 0.12
47 0.13
48 0.14
49 0.19
50 0.23
51 0.25
52 0.33
53 0.38
54 0.4
55 0.47
56 0.54
57 0.59
58 0.66
59 0.74
60 0.75
61 0.8