Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HCX6

Protein Details
Accession A0A397HCX6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-64VQKRSDKKLKRRFACINKNCPHydrophilic
NLS Segment(s)
PositionSequence
50-53KKLK
Subcellular Location(s) mito 6, nucl 5.5, cyto_nucl 4, pero 4, plas 3, extr 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MEAFKFIFLLFLIVSLFNVNDAATSTTISRHSPRPIYKIGVPPVQKRSDKKLKRRFACINKNCPMYSLRKRAYCNCPPRPIYTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.05
7 0.05
8 0.06
9 0.08
10 0.07
11 0.08
12 0.08
13 0.1
14 0.12
15 0.14
16 0.16
17 0.19
18 0.23
19 0.3
20 0.33
21 0.36
22 0.38
23 0.39
24 0.4
25 0.42
26 0.41
27 0.4
28 0.39
29 0.38
30 0.41
31 0.43
32 0.43
33 0.4
34 0.46
35 0.51
36 0.57
37 0.64
38 0.69
39 0.73
40 0.73
41 0.79
42 0.8
43 0.8
44 0.82
45 0.8
46 0.79
47 0.76
48 0.75
49 0.66
50 0.58
51 0.51
52 0.49
53 0.5
54 0.51
55 0.5
56 0.52
57 0.58
58 0.65
59 0.71
60 0.72
61 0.73
62 0.72
63 0.75
64 0.72
65 0.73