Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HQ00

Protein Details
Accession A0A397HQ00    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
74-111RSIQAEKRTEKRRKGKQPVLPSNKTKKKKNNSNENDENHydrophilic
140-177RSIQAEKRTEKRRKGKQPVLPSNKTKKKKNNSNENDENHydrophilic
NLS Segment(s)
PositionSequence
80-102KRTEKRRKGKQPVLPSNKTKKKK
146-168KRTEKRRKGKQPVLPSNKTKKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MEENHTFFDEEREELIEEAGESAHANINRDGCNLSLLTGIIRECDFDKRSWESIHVNQQYNVLDSYRNKSDLARSIQAEKRTEKRRKGKQPVLPSNKTKKKKNNSNENDENLQIDQQQNRNVILIKEVGKVYINKSDLARSIQAEKRTEKRRKGKQPVLPSNKTKKKKNNSNENDENLQIDQQQNRVALEKLNIQKQINDEPEREITLKEKRKQLMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.12
4 0.11
5 0.1
6 0.08
7 0.06
8 0.06
9 0.07
10 0.11
11 0.12
12 0.14
13 0.16
14 0.2
15 0.21
16 0.22
17 0.22
18 0.18
19 0.18
20 0.16
21 0.14
22 0.12
23 0.11
24 0.1
25 0.1
26 0.1
27 0.09
28 0.09
29 0.1
30 0.1
31 0.17
32 0.19
33 0.18
34 0.23
35 0.27
36 0.3
37 0.3
38 0.32
39 0.32
40 0.36
41 0.45
42 0.47
43 0.44
44 0.41
45 0.43
46 0.4
47 0.36
48 0.3
49 0.21
50 0.18
51 0.18
52 0.22
53 0.22
54 0.23
55 0.22
56 0.22
57 0.26
58 0.3
59 0.33
60 0.32
61 0.31
62 0.36
63 0.39
64 0.43
65 0.42
66 0.39
67 0.42
68 0.48
69 0.55
70 0.58
71 0.65
72 0.7
73 0.78
74 0.84
75 0.85
76 0.82
77 0.85
78 0.86
79 0.85
80 0.81
81 0.78
82 0.78
83 0.78
84 0.77
85 0.75
86 0.74
87 0.75
88 0.8
89 0.82
90 0.82
91 0.8
92 0.82
93 0.79
94 0.73
95 0.64
96 0.53
97 0.44
98 0.33
99 0.26
100 0.18
101 0.15
102 0.14
103 0.15
104 0.18
105 0.18
106 0.18
107 0.19
108 0.18
109 0.16
110 0.14
111 0.15
112 0.13
113 0.14
114 0.14
115 0.13
116 0.14
117 0.15
118 0.16
119 0.19
120 0.18
121 0.18
122 0.18
123 0.2
124 0.2
125 0.22
126 0.21
127 0.17
128 0.22
129 0.25
130 0.29
131 0.31
132 0.34
133 0.4
134 0.48
135 0.55
136 0.58
137 0.65
138 0.7
139 0.78
140 0.84
141 0.85
142 0.82
143 0.85
144 0.86
145 0.85
146 0.81
147 0.78
148 0.78
149 0.78
150 0.77
151 0.75
152 0.74
153 0.75
154 0.8
155 0.82
156 0.82
157 0.8
158 0.82
159 0.79
160 0.73
161 0.64
162 0.53
163 0.44
164 0.33
165 0.26
166 0.18
167 0.15
168 0.13
169 0.14
170 0.17
171 0.17
172 0.18
173 0.2
174 0.19
175 0.2
176 0.2
177 0.27
178 0.29
179 0.34
180 0.39
181 0.37
182 0.39
183 0.41
184 0.48
185 0.47
186 0.45
187 0.41
188 0.4
189 0.42
190 0.43
191 0.39
192 0.32
193 0.3
194 0.36
195 0.45
196 0.47
197 0.53