Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GTJ5

Protein Details
Accession A0A397GTJ5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
233-255VKQKIKFRVKFARRRFKKYVLKSHydrophilic
NLS Segment(s)
PositionSequence
234-250KQKIKFRVKFARRRFKK
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
IPR011022  Arrestin_C-like  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF02752  Arrestin_C  
PF00339  Arrestin_N  
Amino Acid Sequences MSQVLRPPKELYKKYSEKLSFCYTPGQSQFQDGYLGITESSVSGILELNFIPDKPIHAKQIDITLKGVEYVFWTEKHGESTKVHRHKEILIRHDLCVWRSPDNTYQQINELQLPFQFELPSHLPSSVKFGNEESKIYYSLKAIMKQESNMLKFRGSTEFIKIRCPITRYSLFPTILIPTQFSNYDDPSTISRGIGYSISLEHNVFSQLNPIIINFGLIFHKPNLKIKEVILGVKQKIKFRVKFARRRFKKYVLKSVIKGNEIKNRLDYNNEYKSSVKFEIPPRNDTKLKSVRHSIDRHYINVSHKIKFKIKFGFFGGSDITWEKDIKIENMITQDLIVIKGNEIKNRLDYNNEYKSSVKFEIPPRNDTKLKSVRHSIDRHYINVSHKIKFKIKFGFFGGSDITWEKDIKIENMITQDLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.71
4 0.64
5 0.64
6 0.65
7 0.57
8 0.5
9 0.54
10 0.45
11 0.46
12 0.47
13 0.47
14 0.39
15 0.41
16 0.4
17 0.33
18 0.33
19 0.25
20 0.22
21 0.17
22 0.17
23 0.12
24 0.11
25 0.1
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.07
32 0.07
33 0.09
34 0.08
35 0.11
36 0.11
37 0.11
38 0.13
39 0.12
40 0.16
41 0.21
42 0.26
43 0.29
44 0.29
45 0.31
46 0.31
47 0.41
48 0.4
49 0.35
50 0.32
51 0.27
52 0.26
53 0.25
54 0.23
55 0.13
56 0.12
57 0.15
58 0.16
59 0.16
60 0.19
61 0.2
62 0.21
63 0.26
64 0.26
65 0.25
66 0.27
67 0.36
68 0.43
69 0.5
70 0.52
71 0.5
72 0.51
73 0.54
74 0.59
75 0.58
76 0.54
77 0.55
78 0.54
79 0.52
80 0.54
81 0.49
82 0.42
83 0.41
84 0.36
85 0.3
86 0.29
87 0.33
88 0.34
89 0.38
90 0.41
91 0.37
92 0.35
93 0.34
94 0.36
95 0.33
96 0.3
97 0.25
98 0.2
99 0.19
100 0.22
101 0.19
102 0.17
103 0.16
104 0.12
105 0.17
106 0.19
107 0.2
108 0.17
109 0.18
110 0.17
111 0.17
112 0.24
113 0.21
114 0.19
115 0.18
116 0.19
117 0.24
118 0.25
119 0.26
120 0.22
121 0.21
122 0.23
123 0.23
124 0.22
125 0.16
126 0.22
127 0.23
128 0.25
129 0.25
130 0.28
131 0.28
132 0.27
133 0.33
134 0.32
135 0.32
136 0.31
137 0.29
138 0.26
139 0.25
140 0.26
141 0.24
142 0.22
143 0.2
144 0.24
145 0.28
146 0.28
147 0.32
148 0.31
149 0.3
150 0.3
151 0.3
152 0.26
153 0.28
154 0.31
155 0.3
156 0.34
157 0.37
158 0.34
159 0.32
160 0.31
161 0.26
162 0.24
163 0.21
164 0.16
165 0.11
166 0.12
167 0.12
168 0.13
169 0.13
170 0.12
171 0.13
172 0.13
173 0.13
174 0.13
175 0.15
176 0.14
177 0.12
178 0.11
179 0.1
180 0.1
181 0.09
182 0.08
183 0.06
184 0.07
185 0.08
186 0.08
187 0.08
188 0.07
189 0.07
190 0.09
191 0.08
192 0.07
193 0.09
194 0.08
195 0.09
196 0.08
197 0.08
198 0.07
199 0.07
200 0.07
201 0.05
202 0.06
203 0.06
204 0.06
205 0.08
206 0.08
207 0.13
208 0.14
209 0.21
210 0.23
211 0.24
212 0.25
213 0.24
214 0.29
215 0.26
216 0.26
217 0.23
218 0.25
219 0.24
220 0.28
221 0.31
222 0.28
223 0.36
224 0.42
225 0.42
226 0.45
227 0.55
228 0.59
229 0.67
230 0.74
231 0.77
232 0.76
233 0.82
234 0.81
235 0.8
236 0.8
237 0.78
238 0.78
239 0.76
240 0.74
241 0.67
242 0.68
243 0.62
244 0.55
245 0.5
246 0.44
247 0.43
248 0.41
249 0.4
250 0.36
251 0.35
252 0.33
253 0.34
254 0.34
255 0.34
256 0.38
257 0.38
258 0.36
259 0.34
260 0.34
261 0.35
262 0.32
263 0.26
264 0.25
265 0.32
266 0.41
267 0.43
268 0.48
269 0.48
270 0.52
271 0.54
272 0.5
273 0.51
274 0.5
275 0.5
276 0.49
277 0.52
278 0.51
279 0.56
280 0.59
281 0.54
282 0.55
283 0.53
284 0.5
285 0.46
286 0.44
287 0.4
288 0.46
289 0.44
290 0.39
291 0.42
292 0.46
293 0.5
294 0.49
295 0.52
296 0.52
297 0.5
298 0.5
299 0.48
300 0.47
301 0.4
302 0.38
303 0.32
304 0.23
305 0.22
306 0.19
307 0.17
308 0.13
309 0.13
310 0.12
311 0.13
312 0.15
313 0.15
314 0.18
315 0.17
316 0.18
317 0.2
318 0.21
319 0.18
320 0.16
321 0.15
322 0.12
323 0.12
324 0.12
325 0.09
326 0.1
327 0.16
328 0.19
329 0.22
330 0.24
331 0.24
332 0.26
333 0.3
334 0.3
335 0.27
336 0.3
337 0.34
338 0.38
339 0.38
340 0.36
341 0.34
342 0.34
343 0.35
344 0.32
345 0.26
346 0.25
347 0.32
348 0.41
349 0.43
350 0.48
351 0.48
352 0.52
353 0.54
354 0.5
355 0.51
356 0.5
357 0.5
358 0.49
359 0.52
360 0.51
361 0.56
362 0.59
363 0.54
364 0.55
365 0.53
366 0.5
367 0.46
368 0.44
369 0.4
370 0.46
371 0.44
372 0.39
373 0.42
374 0.46
375 0.5
376 0.49
377 0.52
378 0.52
379 0.5
380 0.5
381 0.48
382 0.47
383 0.4
384 0.38
385 0.32
386 0.23
387 0.22
388 0.19
389 0.17
390 0.13
391 0.13
392 0.12
393 0.13
394 0.15
395 0.15
396 0.18
397 0.17
398 0.18
399 0.2