Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JBN5

Protein Details
Accession A0A397JBN5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-34NNNNNNEKRKPGQPKKVKRGRPSKQDLLLHydrophilic
NLS Segment(s)
PositionSequence
13-28KRKPGQPKKVKRGRPS
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MMAPKNNNNNNEKRKPGQPKKVKRGRPSKQDLLLQQQQQQEQQQQKQKQQLREQIQKLREQQKQQEKQRLQELKQRLEQLFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.75
3 0.77
4 0.78
5 0.79
6 0.82
7 0.86
8 0.91
9 0.9
10 0.89
11 0.89
12 0.88
13 0.87
14 0.85
15 0.82
16 0.77
17 0.73
18 0.66
19 0.63
20 0.6
21 0.52
22 0.48
23 0.43
24 0.39
25 0.35
26 0.35
27 0.33
28 0.32
29 0.36
30 0.4
31 0.42
32 0.47
33 0.54
34 0.57
35 0.59
36 0.61
37 0.64
38 0.65
39 0.69
40 0.7
41 0.69
42 0.67
43 0.65
44 0.65
45 0.65
46 0.63
47 0.6
48 0.64
49 0.67
50 0.73
51 0.77
52 0.79
53 0.74
54 0.74
55 0.78
56 0.76
57 0.69
58 0.68
59 0.67
60 0.64
61 0.67
62 0.67