Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397J9G6

Protein Details
Accession A0A397J9G6    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-125YEPNSREGRRKPNSKEERRKPNSREKRRKSAKSIQTSSRTHEPNSKKERRKRVKEKDKSTSTDBasic
127-152FMNPRTHKPNSRKKKREENREIPIYNHydrophilic
NLS Segment(s)
PositionSequence
68-120REGRRKPNSKEERRKPNSREKRRKSAKSIQTSSRTHEPNSKKERRKRVKEKDK
131-142RTHKPNSRKKKR
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MKPTVLSSWIRKAHFVFHRYPHEPTSLILEKERERHSYEPMSLILEREGESPFRLPRTSSRIYEPNSREGRRKPNSKEERRKPNSREKRRKSAKSIQTSSRTHEPNSKKERRKRVKEKDKSTSTDIFMNPRTHKPNSRKKKREENREIPIYNLDTDQDNDADNDNEIREVIKKYCVVSKSDSYKQYHGLDAIMEEVNKILKTLIHPISQYHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.5
5 0.58
6 0.58
7 0.6
8 0.53
9 0.48
10 0.44
11 0.38
12 0.38
13 0.34
14 0.32
15 0.3
16 0.32
17 0.32
18 0.39
19 0.42
20 0.37
21 0.37
22 0.37
23 0.41
24 0.42
25 0.41
26 0.36
27 0.33
28 0.32
29 0.28
30 0.26
31 0.2
32 0.15
33 0.15
34 0.13
35 0.14
36 0.11
37 0.12
38 0.15
39 0.16
40 0.18
41 0.18
42 0.18
43 0.23
44 0.3
45 0.34
46 0.33
47 0.37
48 0.41
49 0.44
50 0.52
51 0.49
52 0.5
53 0.53
54 0.53
55 0.53
56 0.54
57 0.6
58 0.6
59 0.66
60 0.63
61 0.67
62 0.75
63 0.8
64 0.84
65 0.84
66 0.86
67 0.85
68 0.88
69 0.84
70 0.84
71 0.84
72 0.85
73 0.86
74 0.83
75 0.86
76 0.87
77 0.88
78 0.85
79 0.84
80 0.82
81 0.81
82 0.78
83 0.73
84 0.71
85 0.64
86 0.6
87 0.56
88 0.49
89 0.4
90 0.43
91 0.41
92 0.43
93 0.52
94 0.58
95 0.6
96 0.67
97 0.77
98 0.79
99 0.85
100 0.86
101 0.88
102 0.89
103 0.9
104 0.91
105 0.9
106 0.85
107 0.78
108 0.72
109 0.64
110 0.54
111 0.49
112 0.4
113 0.34
114 0.32
115 0.33
116 0.31
117 0.33
118 0.37
119 0.37
120 0.45
121 0.51
122 0.58
123 0.64
124 0.73
125 0.76
126 0.79
127 0.87
128 0.87
129 0.89
130 0.89
131 0.87
132 0.84
133 0.83
134 0.75
135 0.65
136 0.59
137 0.49
138 0.39
139 0.3
140 0.22
141 0.15
142 0.15
143 0.15
144 0.12
145 0.11
146 0.11
147 0.12
148 0.12
149 0.11
150 0.11
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.13
157 0.14
158 0.17
159 0.19
160 0.21
161 0.27
162 0.28
163 0.29
164 0.32
165 0.38
166 0.42
167 0.48
168 0.52
169 0.51
170 0.52
171 0.55
172 0.52
173 0.46
174 0.39
175 0.32
176 0.26
177 0.21
178 0.21
179 0.16
180 0.13
181 0.11
182 0.1
183 0.12
184 0.11
185 0.11
186 0.09
187 0.1
188 0.13
189 0.22
190 0.26
191 0.28
192 0.29