Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397IV62

Protein Details
Accession A0A397IV62    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-109SNTQNSNKTTYRRKKENKYNDKNKRQKNHydrophilic
NLS Segment(s)
PositionSequence
94-107RKKENKYNDKNKRQ
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNKTDRMSAKDMLNELKKIAEEGEIQSEEIPEIKTIEEWITRYSASLRKESAEQRISNNNESHANSNVLRELNENQEIVNVSNTQNSNKTTYRRKKENKYNDKNKRQKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.3
4 0.27
5 0.23
6 0.21
7 0.16
8 0.13
9 0.14
10 0.19
11 0.18
12 0.18
13 0.17
14 0.16
15 0.14
16 0.13
17 0.12
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.1
24 0.1
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.14
31 0.17
32 0.18
33 0.19
34 0.19
35 0.19
36 0.23
37 0.25
38 0.3
39 0.3
40 0.28
41 0.29
42 0.35
43 0.37
44 0.37
45 0.35
46 0.29
47 0.27
48 0.28
49 0.27
50 0.21
51 0.21
52 0.18
53 0.18
54 0.18
55 0.16
56 0.15
57 0.15
58 0.15
59 0.17
60 0.18
61 0.17
62 0.15
63 0.16
64 0.16
65 0.15
66 0.14
67 0.11
68 0.1
69 0.15
70 0.17
71 0.18
72 0.21
73 0.22
74 0.26
75 0.3
76 0.37
77 0.43
78 0.53
79 0.6
80 0.68
81 0.76
82 0.81
83 0.88
84 0.92
85 0.92
86 0.93
87 0.94
88 0.95
89 0.96