Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IKN0

Protein Details
Accession A0A397IKN0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-32LDERCKRQTCKKSKISTIINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 11, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006571  TLDc_dom  
PROSITE View protein in PROSITE  
PS51886  TLDC  
Amino Acid Sequences MKFGLRGFGFGFLDERCKRQTCKKSKISTIINEEHIAEISSWIDYKSTIYSLENVTYKLQLILRENEDGFQLQTFWNMCNEHAGMIVVVKVAGTDEILGGYNPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.26
4 0.3
5 0.35
6 0.43
7 0.54
8 0.56
9 0.65
10 0.71
11 0.75
12 0.78
13 0.82
14 0.79
15 0.75
16 0.72
17 0.65
18 0.58
19 0.5
20 0.43
21 0.34
22 0.27
23 0.2
24 0.12
25 0.09
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.1
39 0.12
40 0.12
41 0.12
42 0.12
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.14
49 0.16
50 0.18
51 0.2
52 0.2
53 0.18
54 0.18
55 0.16
56 0.13
57 0.1
58 0.09
59 0.07
60 0.09
61 0.1
62 0.1
63 0.12
64 0.13
65 0.13
66 0.16
67 0.16
68 0.13
69 0.13
70 0.13
71 0.1
72 0.09
73 0.09
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06