Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JM53

Protein Details
Accession A0A397JM53    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-48KDNKQNKCMKSVKRKTQTFSHydrophilic
146-166VSETELRNEDKKKKRGKKEAKBasic
NLS Segment(s)
PositionSequence
156-166KKKKRGKKEAK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTTNDEGPTTVNDELITDQQQTNDRPTIKDNKQNKCMKSVKRKTQTFSQEIVNKLEKTIISFTSSQRRSRTSKQPLQISPPFRLFSSITARTSRPAFLSSSTTKTSRSTSSPSDLRETSLLSFSSTITRTRQNHLYLNIYNYNISVSETELRNEDKKKKRGKKEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.16
5 0.16
6 0.19
7 0.24
8 0.25
9 0.28
10 0.31
11 0.31
12 0.31
13 0.36
14 0.43
15 0.46
16 0.54
17 0.58
18 0.61
19 0.69
20 0.75
21 0.71
22 0.7
23 0.71
24 0.71
25 0.73
26 0.75
27 0.76
28 0.78
29 0.82
30 0.77
31 0.78
32 0.77
33 0.7
34 0.62
35 0.58
36 0.53
37 0.49
38 0.49
39 0.44
40 0.35
41 0.31
42 0.3
43 0.23
44 0.21
45 0.21
46 0.17
47 0.15
48 0.17
49 0.2
50 0.27
51 0.31
52 0.32
53 0.33
54 0.37
55 0.4
56 0.46
57 0.54
58 0.55
59 0.59
60 0.61
61 0.65
62 0.62
63 0.64
64 0.62
65 0.54
66 0.47
67 0.43
68 0.37
69 0.3
70 0.3
71 0.23
72 0.21
73 0.25
74 0.24
75 0.23
76 0.25
77 0.25
78 0.25
79 0.25
80 0.23
81 0.17
82 0.15
83 0.14
84 0.14
85 0.19
86 0.19
87 0.22
88 0.23
89 0.23
90 0.23
91 0.24
92 0.25
93 0.23
94 0.24
95 0.25
96 0.26
97 0.32
98 0.34
99 0.34
100 0.36
101 0.33
102 0.32
103 0.28
104 0.26
105 0.2
106 0.19
107 0.17
108 0.13
109 0.13
110 0.12
111 0.15
112 0.14
113 0.16
114 0.17
115 0.25
116 0.27
117 0.32
118 0.38
119 0.39
120 0.44
121 0.45
122 0.49
123 0.43
124 0.45
125 0.43
126 0.37
127 0.33
128 0.27
129 0.24
130 0.18
131 0.17
132 0.12
133 0.12
134 0.16
135 0.17
136 0.18
137 0.2
138 0.24
139 0.29
140 0.36
141 0.43
142 0.49
143 0.57
144 0.67
145 0.75
146 0.82