Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397HFP4

Protein Details
Accession A0A397HFP4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MDSGKPKDKSGPVSKKKRLRKIPTSPSEINHydrophilic
NLS Segment(s)
PositionSequence
5-21KPKDKSGPVSKKKRLRK
78-86KEKKRNKRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDSGKPKDKSGPVSKKKRLRKIPTSPSEINNFWTDHPAPELSKKQDTNMNDTNDMDDTSDTELYDIFFEDGDFNMEEKEKKRNKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.88
4 0.89
5 0.89
6 0.88
7 0.88
8 0.88
9 0.89
10 0.87
11 0.85
12 0.78
13 0.7
14 0.65
15 0.55
16 0.47
17 0.38
18 0.32
19 0.24
20 0.25
21 0.22
22 0.17
23 0.18
24 0.16
25 0.15
26 0.19
27 0.23
28 0.22
29 0.26
30 0.26
31 0.26
32 0.3
33 0.31
34 0.33
35 0.35
36 0.34
37 0.3
38 0.3
39 0.3
40 0.25
41 0.24
42 0.17
43 0.1
44 0.09
45 0.1
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.06
54 0.05
55 0.06
56 0.07
57 0.07
58 0.09
59 0.09
60 0.09
61 0.1
62 0.12
63 0.16
64 0.17
65 0.28
66 0.34