Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JS34

Protein Details
Accession A0A397JS34    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-99QSILKTSPKARKRKPEPRTNTTKPKVHydrophilic
NLS Segment(s)
PositionSequence
81-98PKARKRKPEPRTNTTKPK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, mito_nucl 11.666
Family & Domain DBs
Amino Acid Sequences MEKTEVSITQVTVRTNIKEYLSEKETGAMSFHLYHYPEEKHLLPISKKIVKGSHLYITGHLSFVQGLMLVKLTQSILKTSPKARKRKPEPRTNTTKPKVPRLAAITLKNTQRIIDEDPKEESSQQAEEVVNVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.26
5 0.28
6 0.29
7 0.32
8 0.32
9 0.31
10 0.28
11 0.27
12 0.27
13 0.22
14 0.21
15 0.14
16 0.13
17 0.13
18 0.14
19 0.14
20 0.15
21 0.15
22 0.18
23 0.2
24 0.19
25 0.21
26 0.21
27 0.22
28 0.23
29 0.28
30 0.25
31 0.28
32 0.34
33 0.34
34 0.34
35 0.34
36 0.34
37 0.31
38 0.33
39 0.32
40 0.29
41 0.27
42 0.26
43 0.24
44 0.25
45 0.22
46 0.19
47 0.16
48 0.11
49 0.09
50 0.09
51 0.07
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.1
64 0.13
65 0.16
66 0.22
67 0.32
68 0.39
69 0.49
70 0.55
71 0.64
72 0.71
73 0.79
74 0.83
75 0.84
76 0.85
77 0.84
78 0.86
79 0.84
80 0.84
81 0.78
82 0.76
83 0.7
84 0.71
85 0.69
86 0.6
87 0.58
88 0.52
89 0.55
90 0.53
91 0.53
92 0.48
93 0.46
94 0.48
95 0.45
96 0.41
97 0.34
98 0.3
99 0.29
100 0.31
101 0.35
102 0.35
103 0.34
104 0.38
105 0.4
106 0.4
107 0.37
108 0.31
109 0.26
110 0.24
111 0.22
112 0.21
113 0.18