Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397IP23

Protein Details
Accession A0A397IP23    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MNLHCFKLKQNKLKQNKLKQNKLKQNKLEKKKNKEIHNYPDESHydrophilic
83-111NYELKTSWGKKKKDKQLNKTIKKKTRYSGHydrophilic
NLS Segment(s)
PositionSequence
12-34KLKQNKLKQNKLKQNKLEKKKNK
91-106GKKKKDKQLNKTIKKK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MNLHCFKLKQNKLKQNKLKQNKLKQNKLEKKKNKEIHNYPDESIIEYSEPERSYTYEIIEERQYPSITYLKYTKGNIFRIPNNYELKTSWGKKKKDKQLNKTIKKKTRYSGSHLFGLHLEILQQSRDACRRVTVLKPFDNLTSTGQNNRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.92
5 0.92
6 0.92
7 0.93
8 0.93
9 0.93
10 0.92
11 0.9
12 0.91
13 0.91
14 0.91
15 0.91
16 0.9
17 0.89
18 0.9
19 0.88
20 0.86
21 0.86
22 0.84
23 0.83
24 0.81
25 0.75
26 0.64
27 0.61
28 0.52
29 0.43
30 0.35
31 0.25
32 0.17
33 0.14
34 0.14
35 0.12
36 0.12
37 0.11
38 0.12
39 0.12
40 0.15
41 0.15
42 0.15
43 0.16
44 0.16
45 0.17
46 0.18
47 0.18
48 0.16
49 0.18
50 0.17
51 0.14
52 0.16
53 0.17
54 0.15
55 0.16
56 0.17
57 0.18
58 0.21
59 0.22
60 0.24
61 0.27
62 0.29
63 0.31
64 0.33
65 0.33
66 0.36
67 0.36
68 0.37
69 0.35
70 0.33
71 0.3
72 0.26
73 0.28
74 0.29
75 0.31
76 0.35
77 0.4
78 0.45
79 0.54
80 0.63
81 0.69
82 0.74
83 0.8
84 0.81
85 0.84
86 0.89
87 0.89
88 0.9
89 0.9
90 0.87
91 0.84
92 0.81
93 0.77
94 0.76
95 0.71
96 0.69
97 0.68
98 0.63
99 0.61
100 0.55
101 0.48
102 0.38
103 0.35
104 0.27
105 0.17
106 0.13
107 0.09
108 0.1
109 0.09
110 0.1
111 0.09
112 0.14
113 0.19
114 0.21
115 0.2
116 0.22
117 0.26
118 0.3
119 0.36
120 0.41
121 0.44
122 0.47
123 0.48
124 0.47
125 0.46
126 0.43
127 0.38
128 0.33
129 0.32
130 0.3
131 0.34