Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JEK6

Protein Details
Accession A0A397JEK6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
75-101KSASLNSKKKCGPKPKRVSFNENYKFKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MIKKLWDEDNNVVSKLSGRLPPHPGEPHRGHHKRYTECRDQEKHSSHACTNSIAKRKCILKSSEPKCIRCEIVNKSASLNSKKKCGPKPKRVSFNENYKFKSYKGCWRNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.22
4 0.21
5 0.22
6 0.27
7 0.32
8 0.35
9 0.39
10 0.44
11 0.43
12 0.46
13 0.48
14 0.5
15 0.56
16 0.59
17 0.57
18 0.57
19 0.62
20 0.62
21 0.68
22 0.68
23 0.67
24 0.68
25 0.73
26 0.7
27 0.67
28 0.67
29 0.6
30 0.57
31 0.51
32 0.47
33 0.4
34 0.39
35 0.34
36 0.28
37 0.29
38 0.3
39 0.35
40 0.32
41 0.33
42 0.34
43 0.37
44 0.37
45 0.38
46 0.37
47 0.38
48 0.47
49 0.49
50 0.55
51 0.56
52 0.55
53 0.53
54 0.51
55 0.44
56 0.37
57 0.4
58 0.35
59 0.39
60 0.39
61 0.37
62 0.35
63 0.37
64 0.39
65 0.4
66 0.42
67 0.35
68 0.4
69 0.45
70 0.53
71 0.59
72 0.65
73 0.68
74 0.71
75 0.81
76 0.84
77 0.89
78 0.87
79 0.87
80 0.84
81 0.84
82 0.83
83 0.78
84 0.73
85 0.68
86 0.63
87 0.55
88 0.57
89 0.51
90 0.52