Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GY24

Protein Details
Accession A0A397GY24    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-46CFNHWKSKKRFPCKVCGKPTHydrophilic
69-98QSNEKFTPKKKCDIKKNYTKKNTISKNLHQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MLGDYTCYYIHNSGEVCGRGCRRPEGCFNHWKSKKRFPCKVCGKPTSSEPGLCRAHVKGYYVMKCLYGQSNEKFTPKKKCDIKKNYTKKNTISKNLHQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.2
4 0.23
5 0.26
6 0.28
7 0.3
8 0.36
9 0.34
10 0.37
11 0.45
12 0.48
13 0.51
14 0.56
15 0.6
16 0.64
17 0.68
18 0.72
19 0.7
20 0.72
21 0.76
22 0.77
23 0.8
24 0.72
25 0.76
26 0.78
27 0.81
28 0.78
29 0.74
30 0.67
31 0.6
32 0.58
33 0.54
34 0.44
35 0.37
36 0.29
37 0.31
38 0.28
39 0.26
40 0.25
41 0.19
42 0.21
43 0.2
44 0.21
45 0.19
46 0.25
47 0.27
48 0.27
49 0.27
50 0.25
51 0.24
52 0.24
53 0.22
54 0.19
55 0.22
56 0.24
57 0.3
58 0.31
59 0.35
60 0.38
61 0.41
62 0.48
63 0.47
64 0.54
65 0.57
66 0.65
67 0.72
68 0.78
69 0.82
70 0.83
71 0.89
72 0.9
73 0.91
74 0.88
75 0.85
76 0.85
77 0.84
78 0.84
79 0.82