Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JJE3

Protein Details
Accession A0A397JJE3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-59VTSLKKDIATKRREKNHRDKENYKKRYRKLQKEEDIESYRKLQKRREKIIRGYKKREEBasic
NLS Segment(s)
PositionSequence
10-69ATKRREKNHRDKENYKKRYRKLQKEEDIESYRKLQKRREKIIRGYKKREEEERGKARMEK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MVTSLKKDIATKRREKNHRDKENYKKRYRKLQKEEDIESYRKLQKRREKIIRGYKKREEEERGKARMEKKCSHGLRFERLNIYRIADRYNVKNFCLKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.87
5 0.88
6 0.88
7 0.88
8 0.89
9 0.91
10 0.91
11 0.9
12 0.88
13 0.84
14 0.86
15 0.87
16 0.87
17 0.86
18 0.86
19 0.85
20 0.82
21 0.79
22 0.75
23 0.69
24 0.59
25 0.5
26 0.44
27 0.41
28 0.39
29 0.39
30 0.41
31 0.45
32 0.54
33 0.62
34 0.67
35 0.68
36 0.74
37 0.81
38 0.83
39 0.82
40 0.8
41 0.77
42 0.74
43 0.71
44 0.68
45 0.64
46 0.61
47 0.62
48 0.62
49 0.57
50 0.52
51 0.53
52 0.54
53 0.54
54 0.54
55 0.49
56 0.47
57 0.54
58 0.57
59 0.56
60 0.57
61 0.55
62 0.56
63 0.56
64 0.55
65 0.53
66 0.51
67 0.49
68 0.42
69 0.4
70 0.37
71 0.33
72 0.32
73 0.29
74 0.31
75 0.35
76 0.43
77 0.42
78 0.4