Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397JDJ5

Protein Details
Accession A0A397JDJ5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
162-184DNNFITRLKRLRKLEKYFKETSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018464  CENP-O  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0034508  P:centromere complex assembly  
Pfam View protein in Pfam  
PF09496  CENP-O  
Amino Acid Sequences MYTQNEYEELLRAYRLIGRTIFPTKGKRVEMRFETFYGAKYHETYYIVLDQNEKNCQLSIFMHTIPHFIPLKELENDYLNKDIYKFRNFVDDYLQAYVKRREEIKILQQNKGIINLSTNNVHDFIEFSVCLEKHTMKISIKYEDLKLCIPTNTVIYQIEEDDNNFITRLKRLRKLEKYFKETSLLKAFDNVFVDAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.18
5 0.19
6 0.24
7 0.29
8 0.32
9 0.33
10 0.38
11 0.42
12 0.47
13 0.51
14 0.53
15 0.54
16 0.59
17 0.6
18 0.6
19 0.57
20 0.5
21 0.49
22 0.42
23 0.38
24 0.31
25 0.27
26 0.22
27 0.21
28 0.21
29 0.19
30 0.2
31 0.19
32 0.19
33 0.22
34 0.22
35 0.21
36 0.23
37 0.23
38 0.25
39 0.27
40 0.25
41 0.21
42 0.2
43 0.19
44 0.17
45 0.16
46 0.17
47 0.17
48 0.16
49 0.18
50 0.17
51 0.19
52 0.17
53 0.2
54 0.17
55 0.14
56 0.16
57 0.16
58 0.19
59 0.19
60 0.2
61 0.16
62 0.18
63 0.19
64 0.19
65 0.18
66 0.15
67 0.14
68 0.15
69 0.19
70 0.2
71 0.23
72 0.22
73 0.21
74 0.29
75 0.29
76 0.28
77 0.27
78 0.25
79 0.23
80 0.23
81 0.24
82 0.16
83 0.19
84 0.22
85 0.18
86 0.18
87 0.17
88 0.17
89 0.2
90 0.23
91 0.3
92 0.36
93 0.38
94 0.38
95 0.39
96 0.4
97 0.37
98 0.35
99 0.26
100 0.17
101 0.16
102 0.15
103 0.15
104 0.14
105 0.14
106 0.13
107 0.13
108 0.13
109 0.11
110 0.11
111 0.1
112 0.1
113 0.09
114 0.08
115 0.12
116 0.12
117 0.12
118 0.14
119 0.14
120 0.14
121 0.17
122 0.21
123 0.19
124 0.25
125 0.27
126 0.29
127 0.3
128 0.31
129 0.32
130 0.3
131 0.3
132 0.26
133 0.26
134 0.24
135 0.22
136 0.21
137 0.18
138 0.19
139 0.17
140 0.17
141 0.15
142 0.15
143 0.15
144 0.16
145 0.16
146 0.14
147 0.14
148 0.14
149 0.14
150 0.13
151 0.12
152 0.13
153 0.13
154 0.18
155 0.26
156 0.32
157 0.4
158 0.49
159 0.6
160 0.69
161 0.77
162 0.83
163 0.84
164 0.84
165 0.8
166 0.73
167 0.7
168 0.61
169 0.58
170 0.55
171 0.47
172 0.4
173 0.4
174 0.39
175 0.36
176 0.36