Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WNY8

Protein Details
Accession K1WNY8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-154EPDTKKSKSVEKKHHARFAABasic
NLS Segment(s)
PositionSequence
8-55RHKRSASGAKRAYYRKKRAFEAGRQESNTRIGAKRIHLVRTRGGNRKF
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mbe:MBM_02632  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSASGAKRAYYRKKRAFEAGRQESNTRIGAKRIHLVRTRGGNRKFRALRLEAGNFSWASEGIARKVRVIVVAFHPSNNELVRTNTLTRSAVVQVDAAPFRQWYEAHYGQNLGRRRQQKAGQEIAEPDTKKSKSVEKKHHARFAAQGKVEPALEKQFEAGRLFAVISSRPGQSGRCDGYILEGEELAFYQRQLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.63
4 0.68
5 0.74
6 0.75
7 0.75
8 0.77
9 0.76
10 0.77
11 0.77
12 0.79
13 0.79
14 0.77
15 0.78
16 0.76
17 0.73
18 0.69
19 0.65
20 0.57
21 0.52
22 0.45
23 0.38
24 0.3
25 0.28
26 0.29
27 0.31
28 0.36
29 0.36
30 0.41
31 0.42
32 0.44
33 0.46
34 0.51
35 0.56
36 0.58
37 0.62
38 0.63
39 0.6
40 0.67
41 0.64
42 0.58
43 0.58
44 0.51
45 0.49
46 0.46
47 0.47
48 0.38
49 0.36
50 0.34
51 0.26
52 0.23
53 0.18
54 0.12
55 0.09
56 0.1
57 0.1
58 0.11
59 0.17
60 0.17
61 0.17
62 0.18
63 0.17
64 0.17
65 0.17
66 0.16
67 0.14
68 0.2
69 0.2
70 0.19
71 0.19
72 0.18
73 0.19
74 0.17
75 0.15
76 0.1
77 0.11
78 0.13
79 0.15
80 0.16
81 0.15
82 0.16
83 0.15
84 0.15
85 0.15
86 0.13
87 0.11
88 0.1
89 0.1
90 0.09
91 0.1
92 0.1
93 0.08
94 0.07
95 0.07
96 0.07
97 0.09
98 0.08
99 0.08
100 0.16
101 0.19
102 0.2
103 0.2
104 0.22
105 0.22
106 0.29
107 0.31
108 0.26
109 0.3
110 0.34
111 0.37
112 0.42
113 0.47
114 0.48
115 0.51
116 0.54
117 0.49
118 0.45
119 0.43
120 0.39
121 0.38
122 0.31
123 0.25
124 0.25
125 0.24
126 0.25
127 0.25
128 0.32
129 0.37
130 0.47
131 0.56
132 0.6
133 0.7
134 0.77
135 0.82
136 0.74
137 0.66
138 0.64
139 0.61
140 0.58
141 0.49
142 0.42
143 0.36
144 0.36
145 0.34
146 0.27
147 0.21
148 0.19
149 0.19
150 0.17
151 0.18
152 0.18
153 0.21
154 0.21
155 0.19
156 0.14
157 0.14
158 0.14
159 0.13
160 0.12
161 0.1
162 0.12
163 0.15
164 0.15
165 0.15
166 0.17
167 0.18
168 0.21
169 0.28
170 0.29
171 0.28
172 0.28
173 0.26
174 0.3
175 0.31
176 0.28
177 0.21
178 0.17
179 0.16
180 0.15
181 0.16
182 0.13
183 0.1
184 0.09