Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397HTU2

Protein Details
Accession A0A397HTU2    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-39KELIITRSKKVNKGKKRKTLRRIMKNSTNQVTKHydrophilic
NLS Segment(s)
PositionSequence
13-30RSKKVNKGKKRKTLRRIM
96-113KKEKKLGEEKLTRKKIPR
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MPRGNPKELIITRSKKVNKGKKRKTLRRIMKNSTNQVTKRILPKSPQQPEWKKLKTLNAPPTTSFVDNLMRRNETTMEMIKVLPLRKQTTKWSYTKKEKKLGEEKLTRKKIPRLPRINDDNDAYEEFGEDLLHSIPLPYNNNNHYGLSNNTNGEYENSSRQQSRFPNYEDDQRPRETKAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.64
4 0.69
5 0.7
6 0.76
7 0.84
8 0.85
9 0.91
10 0.93
11 0.93
12 0.93
13 0.93
14 0.93
15 0.92
16 0.91
17 0.89
18 0.88
19 0.86
20 0.82
21 0.79
22 0.69
23 0.65
24 0.6
25 0.54
26 0.53
27 0.49
28 0.46
29 0.42
30 0.5
31 0.55
32 0.58
33 0.61
34 0.63
35 0.67
36 0.7
37 0.76
38 0.7
39 0.64
40 0.61
41 0.63
42 0.61
43 0.63
44 0.65
45 0.61
46 0.59
47 0.55
48 0.54
49 0.48
50 0.4
51 0.31
52 0.23
53 0.24
54 0.24
55 0.27
56 0.26
57 0.24
58 0.24
59 0.25
60 0.24
61 0.19
62 0.19
63 0.17
64 0.15
65 0.15
66 0.15
67 0.14
68 0.16
69 0.15
70 0.14
71 0.16
72 0.2
73 0.21
74 0.24
75 0.31
76 0.35
77 0.4
78 0.44
79 0.49
80 0.53
81 0.62
82 0.69
83 0.69
84 0.7
85 0.67
86 0.69
87 0.7
88 0.7
89 0.68
90 0.67
91 0.68
92 0.7
93 0.73
94 0.68
95 0.63
96 0.64
97 0.62
98 0.64
99 0.67
100 0.66
101 0.66
102 0.71
103 0.74
104 0.69
105 0.64
106 0.56
107 0.47
108 0.4
109 0.34
110 0.26
111 0.19
112 0.14
113 0.12
114 0.1
115 0.07
116 0.05
117 0.06
118 0.06
119 0.06
120 0.05
121 0.06
122 0.07
123 0.11
124 0.14
125 0.16
126 0.22
127 0.24
128 0.28
129 0.29
130 0.29
131 0.26
132 0.25
133 0.26
134 0.25
135 0.26
136 0.23
137 0.22
138 0.21
139 0.21
140 0.21
141 0.21
142 0.2
143 0.24
144 0.26
145 0.29
146 0.33
147 0.33
148 0.38
149 0.42
150 0.46
151 0.46
152 0.47
153 0.51
154 0.51
155 0.61
156 0.61
157 0.62
158 0.59
159 0.59
160 0.58