Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397JNF5

Protein Details
Accession A0A397JNF5    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-122QPSNIVRKRRHGFRARLKNRNGRRILTRRRMKGRKFLSHBasic
NLS Segment(s)
PositionSequence
90-119RKRRHGFRARLKNRNGRRILTRRRMKGRKF
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFFFVRRICPIIQKIHHKSPSYSNNNNSKGSLLSGIFSSLNSSPTTRLAHLTLPLQTTTTTFNTTTNLFGFIQVRFRAYGREYQPSNIVRKRRHGFRARLKNRNGRRILTRRRMKGRKFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.71
4 0.66
5 0.64
6 0.64
7 0.67
8 0.66
9 0.65
10 0.64
11 0.66
12 0.68
13 0.66
14 0.57
15 0.47
16 0.39
17 0.33
18 0.27
19 0.17
20 0.13
21 0.12
22 0.13
23 0.11
24 0.1
25 0.12
26 0.09
27 0.11
28 0.11
29 0.11
30 0.11
31 0.14
32 0.16
33 0.14
34 0.16
35 0.16
36 0.16
37 0.17
38 0.17
39 0.16
40 0.15
41 0.14
42 0.13
43 0.11
44 0.11
45 0.12
46 0.12
47 0.13
48 0.12
49 0.12
50 0.13
51 0.14
52 0.14
53 0.11
54 0.13
55 0.11
56 0.12
57 0.12
58 0.12
59 0.15
60 0.14
61 0.15
62 0.13
63 0.13
64 0.15
65 0.16
66 0.23
67 0.22
68 0.29
69 0.29
70 0.3
71 0.36
72 0.37
73 0.43
74 0.41
75 0.46
76 0.44
77 0.53
78 0.59
79 0.61
80 0.67
81 0.69
82 0.74
83 0.77
84 0.84
85 0.84
86 0.86
87 0.86
88 0.86
89 0.86
90 0.86
91 0.8
92 0.75
93 0.75
94 0.77
95 0.79
96 0.79
97 0.8
98 0.79
99 0.85
100 0.9
101 0.87
102 0.87