Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GJT6

Protein Details
Accession A0A397GJT6    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-72TRENIKPALRQKRTKPNLIPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.833, mito 13.5, nucl 13, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGRKKSSVIGNFWKTKSNAVKTLKRASTLNSPNLINRMLNLRSDYNDALTNTTRENIKPALRQKRTKPNLIPIQVIQY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.55
4 0.51
5 0.52
6 0.53
7 0.59
8 0.6
9 0.68
10 0.61
11 0.55
12 0.5
13 0.45
14 0.47
15 0.45
16 0.43
17 0.36
18 0.35
19 0.33
20 0.34
21 0.31
22 0.21
23 0.16
24 0.16
25 0.14
26 0.14
27 0.15
28 0.14
29 0.15
30 0.18
31 0.18
32 0.14
33 0.16
34 0.16
35 0.16
36 0.17
37 0.16
38 0.14
39 0.16
40 0.16
41 0.14
42 0.17
43 0.19
44 0.23
45 0.29
46 0.38
47 0.47
48 0.55
49 0.63
50 0.69
51 0.76
52 0.78
53 0.8
54 0.78
55 0.77
56 0.79
57 0.75
58 0.7