Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397GJA3

Protein Details
Accession A0A397GJA3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-95EVYKKLDRRMKERYHKCKTNEGKIBasic
NLS Segment(s)
PositionSequence
29-44KKNNGKDIKTKSDKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MFVKILINKDKNKYIKIKDKIEKTSILTKKNNGKDIKTKSDKKKTPISTNKNKGEELITIDEETFITPELKEVYKKLDRRMKERYHKCKTNEGKIVLLETIRYHNQKGDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.71
4 0.75
5 0.74
6 0.77
7 0.77
8 0.71
9 0.65
10 0.59
11 0.61
12 0.56
13 0.56
14 0.51
15 0.52
16 0.57
17 0.6
18 0.63
19 0.57
20 0.56
21 0.58
22 0.61
23 0.64
24 0.64
25 0.67
26 0.7
27 0.77
28 0.77
29 0.73
30 0.75
31 0.72
32 0.74
33 0.75
34 0.74
35 0.74
36 0.78
37 0.8
38 0.73
39 0.66
40 0.56
41 0.47
42 0.38
43 0.3
44 0.23
45 0.16
46 0.14
47 0.14
48 0.13
49 0.11
50 0.1
51 0.07
52 0.05
53 0.05
54 0.05
55 0.06
56 0.08
57 0.09
58 0.1
59 0.11
60 0.18
61 0.25
62 0.29
63 0.37
64 0.43
65 0.46
66 0.52
67 0.61
68 0.64
69 0.68
70 0.76
71 0.77
72 0.8
73 0.84
74 0.81
75 0.82
76 0.8
77 0.8
78 0.77
79 0.69
80 0.62
81 0.55
82 0.52
83 0.43
84 0.34
85 0.25
86 0.19
87 0.21
88 0.24
89 0.26
90 0.26