Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397ILF9

Protein Details
Accession A0A397ILF9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-114NNNKSIINSRNNNKRKRRAPGYLKDYVYHydrophilic
NLS Segment(s)
PositionSequence
100-104KRKRR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MNPTEIAGRNAFLHFVNIVNNRNNNNNNNNNRSNSINNNNYELEGRRAFLFFVYNINHTNNNSNNNAIININNNNNNNNNNINDIKNNNKSIINSRNNNKRKRRAPGYLKDYVYGIKKQRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.18
4 0.2
5 0.24
6 0.29
7 0.33
8 0.33
9 0.4
10 0.45
11 0.46
12 0.5
13 0.55
14 0.58
15 0.61
16 0.63
17 0.59
18 0.56
19 0.53
20 0.48
21 0.46
22 0.46
23 0.45
24 0.42
25 0.42
26 0.4
27 0.37
28 0.34
29 0.28
30 0.24
31 0.19
32 0.18
33 0.15
34 0.15
35 0.14
36 0.13
37 0.12
38 0.08
39 0.11
40 0.11
41 0.12
42 0.14
43 0.15
44 0.16
45 0.16
46 0.2
47 0.19
48 0.21
49 0.21
50 0.19
51 0.18
52 0.17
53 0.17
54 0.13
55 0.11
56 0.11
57 0.12
58 0.15
59 0.18
60 0.19
61 0.21
62 0.23
63 0.23
64 0.24
65 0.23
66 0.21
67 0.21
68 0.22
69 0.22
70 0.23
71 0.25
72 0.3
73 0.33
74 0.34
75 0.32
76 0.32
77 0.33
78 0.38
79 0.44
80 0.45
81 0.47
82 0.54
83 0.62
84 0.69
85 0.77
86 0.8
87 0.8
88 0.81
89 0.84
90 0.85
91 0.85
92 0.87
93 0.88
94 0.85
95 0.83
96 0.75
97 0.66
98 0.58
99 0.51
100 0.46
101 0.42