Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GWA6

Protein Details
Accession A0A397GWA6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-31NTSSAKITKASKKNFRRKLKRYAKRAEESIHydrophilic
NLS Segment(s)
PositionSequence
10-26KASKKNFRRKLKRYAKR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MNTSSAKITKASKKNFRRKLKRYAKRAEESISTLNTSNDNQNNRNNQDNKKANIFYDPNKGQSLPFEAGRKEDPTRFPPSNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.85
3 0.89
4 0.9
5 0.88
6 0.9
7 0.9
8 0.89
9 0.88
10 0.88
11 0.86
12 0.81
13 0.77
14 0.69
15 0.6
16 0.54
17 0.46
18 0.36
19 0.28
20 0.23
21 0.2
22 0.18
23 0.16
24 0.17
25 0.19
26 0.22
27 0.24
28 0.28
29 0.34
30 0.35
31 0.42
32 0.43
33 0.42
34 0.49
35 0.52
36 0.49
37 0.49
38 0.48
39 0.4
40 0.42
41 0.41
42 0.35
43 0.38
44 0.37
45 0.34
46 0.35
47 0.35
48 0.28
49 0.27
50 0.29
51 0.23
52 0.25
53 0.25
54 0.25
55 0.28
56 0.31
57 0.33
58 0.32
59 0.35
60 0.37
61 0.39
62 0.47