Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397GNU7

Protein Details
Accession A0A397GNU7    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-123TEKIEKIIKKRKIEKPNPIYSQHydrophilic
NLS Segment(s)
PositionSequence
110-113KKRK
Subcellular Location(s) nucl 23, pero 3
Family & Domain DBs
Amino Acid Sequences MAGKAKTAIDSHHAQISQAIKRYIKLGYDINSGDDIESAIKNIAGTRVANLNPNRDNDKAKLGTITGISNYQEWTWPTDEENSGYIFARALPGIGEWKIWSTEKIEKIIKKRKIEKPNPIYSQPSELNKLWTMPINPVLVDITNITNQEIVEIPTSRDSPSETNDHRNQKIIGNNVPFWNSKPRQKLNAQQMHEEQQQRARADFPRFETNDHRNQKIIGNNVPFWNSKPRQKLNAQQMHEEQQQRARADFPRLCSSTFHLLFLRFSGLFNAFLRILDKILIKESD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.34
4 0.34
5 0.36
6 0.38
7 0.34
8 0.35
9 0.37
10 0.35
11 0.3
12 0.29
13 0.28
14 0.27
15 0.31
16 0.31
17 0.3
18 0.28
19 0.27
20 0.23
21 0.18
22 0.14
23 0.11
24 0.11
25 0.09
26 0.09
27 0.09
28 0.09
29 0.1
30 0.11
31 0.11
32 0.11
33 0.12
34 0.17
35 0.17
36 0.25
37 0.27
38 0.32
39 0.34
40 0.38
41 0.4
42 0.39
43 0.42
44 0.37
45 0.43
46 0.37
47 0.34
48 0.32
49 0.27
50 0.26
51 0.23
52 0.21
53 0.14
54 0.14
55 0.14
56 0.13
57 0.14
58 0.12
59 0.14
60 0.13
61 0.16
62 0.16
63 0.16
64 0.17
65 0.19
66 0.2
67 0.19
68 0.19
69 0.16
70 0.15
71 0.15
72 0.13
73 0.1
74 0.09
75 0.09
76 0.07
77 0.07
78 0.06
79 0.06
80 0.08
81 0.08
82 0.08
83 0.07
84 0.09
85 0.1
86 0.11
87 0.11
88 0.13
89 0.19
90 0.21
91 0.26
92 0.3
93 0.34
94 0.43
95 0.52
96 0.55
97 0.57
98 0.65
99 0.7
100 0.76
101 0.8
102 0.81
103 0.8
104 0.82
105 0.78
106 0.71
107 0.66
108 0.55
109 0.52
110 0.44
111 0.38
112 0.33
113 0.29
114 0.29
115 0.25
116 0.24
117 0.19
118 0.18
119 0.16
120 0.13
121 0.16
122 0.13
123 0.13
124 0.12
125 0.12
126 0.1
127 0.09
128 0.08
129 0.06
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.08
140 0.08
141 0.09
142 0.11
143 0.1
144 0.1
145 0.11
146 0.11
147 0.14
148 0.2
149 0.21
150 0.28
151 0.35
152 0.41
153 0.4
154 0.4
155 0.39
156 0.36
157 0.38
158 0.35
159 0.33
160 0.3
161 0.31
162 0.3
163 0.31
164 0.27
165 0.25
166 0.31
167 0.3
168 0.34
169 0.41
170 0.45
171 0.5
172 0.56
173 0.62
174 0.63
175 0.67
176 0.62
177 0.58
178 0.56
179 0.54
180 0.54
181 0.48
182 0.39
183 0.36
184 0.39
185 0.35
186 0.33
187 0.31
188 0.31
189 0.34
190 0.36
191 0.36
192 0.39
193 0.39
194 0.42
195 0.46
196 0.47
197 0.52
198 0.53
199 0.5
200 0.42
201 0.43
202 0.43
203 0.39
204 0.37
205 0.32
206 0.3
207 0.3
208 0.3
209 0.31
210 0.27
211 0.25
212 0.31
213 0.3
214 0.34
215 0.41
216 0.45
217 0.5
218 0.56
219 0.62
220 0.63
221 0.67
222 0.62
223 0.58
224 0.56
225 0.54
226 0.54
227 0.48
228 0.39
229 0.36
230 0.39
231 0.35
232 0.33
233 0.31
234 0.29
235 0.37
236 0.39
237 0.39
238 0.43
239 0.43
240 0.44
241 0.43
242 0.44
243 0.44
244 0.41
245 0.38
246 0.32
247 0.32
248 0.31
249 0.3
250 0.29
251 0.19
252 0.19
253 0.2
254 0.19
255 0.2
256 0.2
257 0.22
258 0.18
259 0.19
260 0.2
261 0.17
262 0.16
263 0.16
264 0.18
265 0.16