Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397J587

Protein Details
Accession A0A397J587    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-60SQNIKAKDKKLGRKKPNNTSTMHydrophilic
NLS Segment(s)
PositionSequence
44-53AKDKKLGRKK
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MGNSKDGKLVVLRSMYKLKLLLFQLWKYRCEKFLIWERSQNIKAKDKKLGRKKPNNTSTMIDESIDMRVYDDVIYDQQQQTKNLQICNYDMDYGSGEKRNSFNTXVNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.3
5 0.27
6 0.27
7 0.28
8 0.3
9 0.3
10 0.33
11 0.4
12 0.4
13 0.42
14 0.4
15 0.4
16 0.35
17 0.35
18 0.33
19 0.31
20 0.39
21 0.44
22 0.43
23 0.46
24 0.47
25 0.49
26 0.52
27 0.51
28 0.45
29 0.46
30 0.5
31 0.48
32 0.53
33 0.54
34 0.6
35 0.66
36 0.71
37 0.73
38 0.77
39 0.82
40 0.84
41 0.84
42 0.77
43 0.69
44 0.61
45 0.55
46 0.48
47 0.4
48 0.29
49 0.21
50 0.19
51 0.17
52 0.15
53 0.1
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.09
62 0.12
63 0.13
64 0.18
65 0.21
66 0.22
67 0.24
68 0.3
69 0.32
70 0.31
71 0.32
72 0.3
73 0.28
74 0.31
75 0.3
76 0.24
77 0.21
78 0.19
79 0.19
80 0.19
81 0.21
82 0.21
83 0.2
84 0.22
85 0.24
86 0.26
87 0.29