Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397H2B9

Protein Details
Accession A0A397H2B9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKKYQVKWSKGKVKEKANNAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPKKYQVKWSKGKVKEKANNAVVLEKATYDKLFKDVPSYKLITPSVLVDRLHVNGSLARVAIRELEAKGLIRKISSHGSQLIYTRATAAIDIPEEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.81
4 0.8
5 0.73
6 0.67
7 0.59
8 0.53
9 0.42
10 0.35
11 0.27
12 0.18
13 0.16
14 0.13
15 0.13
16 0.11
17 0.11
18 0.13
19 0.14
20 0.14
21 0.2
22 0.23
23 0.25
24 0.28
25 0.3
26 0.28
27 0.3
28 0.3
29 0.23
30 0.19
31 0.18
32 0.16
33 0.16
34 0.15
35 0.12
36 0.13
37 0.13
38 0.13
39 0.11
40 0.1
41 0.09
42 0.09
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.1
53 0.1
54 0.11
55 0.13
56 0.15
57 0.14
58 0.13
59 0.14
60 0.16
61 0.21
62 0.22
63 0.23
64 0.24
65 0.26
66 0.27
67 0.28
68 0.28
69 0.23
70 0.21
71 0.19
72 0.16
73 0.14
74 0.13
75 0.12
76 0.11